From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0120 [new locus tag: NWMN_RS00665 ]
  • pan locus tag?: SAUPAN001014000
  • symbol: NWMN_0120
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0120 [new locus tag: NWMN_RS00665 ]
  • symbol: NWMN_0120
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 145382..145741
  • length: 360
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    GTGAATACTATAGATACGCATACTAAAGAACAACAATTCTCGAATCTAGTAAGATCTTAT
    CGTAAAGAATACGTGGGTAAAGGACCCAATAGTATTCGAGTGTCGTTTAAAGATAATTGG
    GCGATTGCACATATGACAGGTGTTTTGAGTAAAGTTGAGAGTTTTTACCTAAACGACAAA
    CGCAATGAATCGATGCTCCATTATACACGCACAGAGAAGATTAAACAGATGTATAAAGAA
    ATAGATGTAAATGAGATGGAAAGTCTTGTAGGCGCTAAGTTTGTAAAATTATTTACAGAT
    ATTGATTTGAATGATGATGAAGTCATTTCAATATTTGTTTTCGATAAGTCAATAGAATAA
    60
    120
    180
    240
    300
    360

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0120 [new locus tag: NWMN_RS00665 ]
  • symbol: NWMN_0120
  • description: hypothetical protein
  • length: 119
  • theoretical pI: 6.26459
  • theoretical MW: 13979.8
  • GRAVY: -0.536134

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    conserved hypothetical protein (TIGR01741; HMM-score: 15.5)
  • TheSEED:  
    FIG01108230: hypothetical protein 
  • PFAM:
    no clan definedDUF2294; Uncharacterized conserved protein (DUF2294) (PF10057; HMM-score: 115.5)
    DUF3269; Protein of unknown function (DUF3269) (PF11673; HMM-score: 14.1)
    APO_RNA-bind; APO RNA-binding (PF05634; HMM-score: 12.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.138
    • Ymax_pos: 22
    • Cmax: 0.121
    • Cmax_pos: 22
    • Smax: 0.196
    • Smax_pos: 17
    • Smean: 0.153
    • D: 0.144
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNTIDTHTKEQQFSNLVRSYRKEYVGKGPNSIRVSFKDNWAIAHMTGVLSKVESFYLNDKRNESMLHYTRTEKIKQMYKEIDVNEMESLVGAKFVKLFTDIDLNDDEVISIFVFDKSIE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]