From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0126 [new locus tag: NWMN_RS00695 ]
  • pan locus tag?: SAUPAN001021000
  • symbol: NWMN_0126
  • pan gene symbol?: argB
  • synonym:
  • product: acetylglutamate kinase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0126 [new locus tag: NWMN_RS00695 ]
  • symbol: NWMN_0126
  • product: acetylglutamate kinase
  • replicon: chromosome
  • strand: -
  • coordinates: 157931..158695
  • length: 765
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAAATTTATTGTCATTAAAATTGGTGGCAGTACACTTAGTGACATGCATCCATCAATT
    ATTAACAACATTAAGCATTTACGATCAAACAACATCTACCCCATTATCGTTCATGGCGGT
    GGCCCATTTATTAATGAAGCATTATCAAACCAGCAAATCGAGCCACACTTTGTTAATGGC
    CTAAGAGTGACTGATAAAGCAACCATGACCATTACTAAACACACGCTCATTGCAGACGTT
    AACACTGCATTAGTAGCTCAATTTAACCAGCACCAATGTTCTGCAATAGGCTTATGTGGT
    TTGGATGCACAGCTGTTTGAAATTACATCTTTTGATCAACAATATGGATATGTCGGTGTT
    CCGACCGCTTTAAATAAGGATGCTTTACAGTATTTATGTACTAAATTTGTACCTATCATC
    AATTCGATTGGTTTCAATAACCATGATGGAGAATTTTACAATATTAATGCTGACACGCTT
    GCCTATTTTATTGCATCATCATTAAAAGCGCCTATTTATGTATTAAGTAATATTGCAGGT
    GTACTCATCAATGATGTTGTTATACCTCAATTGCCATTAGTCGATATTCATCAATATATT
    GAACATGGTGATATTTATGGAGGTATGATTCCCAAAGTGCTAGATGCCAAAAATGCGATT
    GAAAATGGCTGTCCTAAAGTTATCATTGCATCAGGAAACAAGCCAAATATCATTGAATCT
    ATTTACAATAATGATTTTGTTGGCACAACAATCCTTAATTCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    765

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0126 [new locus tag: NWMN_RS00695 ]
  • symbol: NWMN_0126
  • description: acetylglutamate kinase
  • length: 254
  • theoretical pI: 6.21852
  • theoretical MW: 27738.7
  • GRAVY: 0.183858

Function[edit source | edit]

  • reaction:
    EC 2.7.2.8?  ExPASy
    Acetylglutamate kinaseATP + N-acetyl-L-glutamate = ADP + N-acetyl-L-glutamate 5-phosphate
  • TIGRFAM:
    MetabolismAmino acid biosynthesisGlutamate familyacetylglutamate kinase (TIGR00761; EC 2.7.2.8; HMM-score: 284.1)
    MetabolismAmino acid biosynthesisGlutamate familyamino-acid N-acetyltransferase (TIGR01890; EC 2.3.1.1; HMM-score: 51.3)
    MetabolismAmino acid biosynthesisGlutamate familyglutamate 5-kinase (TIGR01027; EC 2.7.2.11; HMM-score: 18.6)
    MetabolismAmino acid biosynthesisGlutamate familydelta l-pyrroline-5-carboxylate synthetase (TIGR01092; HMM-score: 17.3)
    Unknown functionEnzymes of unknown specificityCof-like hydrolase (TIGR00099; HMM-score: 14)
  • TheSEED:  
    Amino Acids and DerivativesArginine; urea cycle, polyaminesArginine Biosynthesis extended Acetylglutamate kinase (EC 2.7.2.8) 
  • PFAM:
    no clan definedAA_kinase; Amino acid kinase family (PF00696; HMM-score: 137.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.172
    • Ymax_pos: 13
    • Cmax: 0.111
    • Cmax_pos: 22
    • Smax: 0.332
    • Smax_pos: 14
    • Smean: 0.293
    • D: 0.219
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKFIVIKIGGSTLSDMHPSIINNIKHLRSNNIYPIIVHGGGPFINEALSNQQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLDAQLFEITSFDQQYGYVGVPTALNKDALQYLCTKFVPIINSIGFNNHDGEFYNINADTLAYFIASSLKAPIYVLSNIAGVLINDVVIPQLPLVDIHQYIEHGDIYGGMIPKVLDAKNAIENGCPKVIIASGNKPNIIESIYNNDFVGTTILNS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: AhrC (ArgR*)
    AhrC  (ArgR*) (TF) important in Arginine biosynthesis, Arginine degradation  RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]