From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0266
  • pan locus tag?: SAUPAN000544000
  • symbol: NWMN_0266
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0266
  • symbol: NWMN_0266
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 323762..324283
  • length: 522
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGTTATGTTCTTTCAAAGCCATTTTAGATTTCAAAAGTTTAGTATCTATAGGCATTTCT
    TTTCACCACCTTTCGCATTACGTAAGTAATCTTATCATGATGTTACAAAAGAGGTCAAGC
    ATTTTACGAAAGTTTTTTAGAAAAATATTGCAAATGCCGAAAGTTTTCCTTATAATAGAA
    CTATCAAGTAAAAGGAGCTGTATTACGATGTGCTTTTCAAAAAGAATGAAACAATCAAGA
    GAAAAACAAGGTATGACTTTGGCCGAACTAGGAAGAAAAATTGGTAAAACTGAAGCTACT
    GTACAACGTTATGAAAGCGGAAATATCAAAAATCTAAAAAACGATACTATAGAAAGTATA
    GCTACTGCATTAAATGTTAATCCTGCGTATTTAATGGGGTGGGTTGAAGAAAACGATGAT
    GAAGTACAACATCGTGCAGCTCATTTAGAAGGAGAATTAACTGATGACGAGTGGCAAAGA
    GTTTTAGATTATGCAGATTATATAAGAAGTAAACGTAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    522

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0266
  • symbol: NWMN_0266
  • description: hypothetical protein
  • length: 173
  • theoretical pI: 9.95838
  • theoretical MW: 20120.3
  • GRAVY: -0.346243

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 25.4)
    Genetic information processingMobile and extrachromosomal element functionsProphage functionsphage portal protein, HK97 family (TIGR01537; HMM-score: 16.5)
    Hypothetical proteinsConservedTIGR00270 family protein (TIGR00270; HMM-score: 16.4)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 16)
    probable regulatory domain (TIGR03879; HMM-score: 14.2)
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, y4mF family (TIGR03070; HMM-score: 14)
    Unknown functionGeneralmobile mystery protein A (TIGR02612; HMM-score: 12.7)
    Cellular processesCellular processesDetoxificationcyanase (TIGR00673; EC 4.2.1.104; HMM-score: 12.6)
  • TheSEED:  
    CI-like repressor, phage associated 
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 49.1)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 39.2)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 38.6)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 31.8)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 18.8)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 18.8)
    HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 18.5)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 17.3)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 13.8)
    Pou; Pou domain - N-terminal to homeobox domain (PF00157; HMM-score: 13.3)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 12.6)
    no clan definedGP57; Phage Tail fiber assembly helper protein (PF17594; HMM-score: 12.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 0.83
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.186
    • Ymax_pos: 13
    • Cmax: 0.134
    • Cmax_pos: 28
    • Smax: 0.387
    • Smax_pos: 11
    • Smean: 0.35
    • D: 0.25
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLCSFKAILDFKSLVSIGISFHHLSHYVSNLIMMLQKRSSILRKFFRKILQMPKVFLIIELSSKRSCITMCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHLEGELTDDEWQRVLDYADYIRSKRK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]