From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0367 [new locus tag: NWMN_RS02080 ]
  • pan locus tag?: SAUPAN001975000
  • symbol: NWMN_0367
  • pan gene symbol?:
  • synonym:
  • product: phosphoglycerate mutase family protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0367 [new locus tag: NWMN_RS02080 ]
  • symbol: NWMN_0367
  • product: phosphoglycerate mutase family protein
  • replicon: chromosome
  • strand: +
  • coordinates: 415111..415692
  • length: 582
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGACGATTTATTTAGTTAGACATGGCGAATCAAAATCGAATTATGATAATAAACATTTT
    CGATCTTATTTTTGTGGACAATTAGATGTGCCGTTAACGGATACTGGCACAAAAAGTGCA
    GACGATTTATGTGATTATTTTAAAGAGAAACAGATTAAACATGTATATGTTTCAGACTTA
    TTAAGAACACAGCAAACGTTTGAACATATTTTTCCATATGACATTGCATCAACGACTACC
    CCTCTATTAAGAGAACGTTCACTTGGCGTATTTGAGGGTGAATATAAAGATGAAATCAGT
    GCGAATCCGAAATATGAAAAATATTTCAATGATCCAAACTTTAAAGACTTTCGTCATAGT
    TTTTCACAAAAAGCGCCTGAAGGAGAAAGTTATGAAGATGTATATCAACGCGTAGAACAT
    TTTATGAATCATGTTGTCAATGAAGATACACAAAAAGATGATATTGTCATTGTTGCACAT
    CAAGTTGTCATTCGTTGTTTGATGGTTTATTTTAACAAAGTTTCAAGGGCAGAAGCTGTG
    GATTTAAAGGTAGAAAATTGCAAACCATATATCATTGAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    582

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0367 [new locus tag: NWMN_RS02080 ]
  • symbol: NWMN_0367
  • description: phosphoglycerate mutase family protein
  • length: 193
  • theoretical pI: 5.57611
  • theoretical MW: 22733.3
  • GRAVY: -0.637824

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminalpha-ribazole phosphatase (TIGR03162; EC 3.1.3.73; HMM-score: 115)
    phosphoglycerate mutase 1 family (TIGR01258; HMM-score: 60.6)
    probable phosphomutase, MSMEG_4193 family (TIGR03848; EC 5.4.2.-; HMM-score: 36.2)
    Signal transductionRegulatory functionsProtein interactionsphosphohistidine phosphatase SixA (TIGR00249; EC 3.1.3.-; HMM-score: 25.9)
  • TheSEED:  
    CBSS-196164.1.peg.461 Phosphoglycerate mutase family protein 
  • PFAM:
    His_phosphatase (CL0071) His_Phos_1; Histidine phosphatase superfamily (branch 1) (PF00300; HMM-score: 139.2)
    no clan definedUNC45-central; Myosin-binding striated muscle assembly central (PF11701; HMM-score: 13.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.171
    • Ymax_pos: 41
    • Cmax: 0.205
    • Cmax_pos: 41
    • Smax: 0.247
    • Smax_pos: 37
    • Smean: 0.123
    • D: 0.152
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADDLCDYFKEKQIKHVYVSDLLRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDPNFKDFRHSFSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFNKVSRAEAVDLKVENCKPYIIE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]