From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0368 [new locus tag: NWMN_RS02085 ]
  • pan locus tag?: SAUPAN001976000
  • symbol: NWMN_0368
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0368 [new locus tag: NWMN_RS02085 ]
  • symbol: NWMN_0368
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 415758..416150
  • length: 393
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGATCATGATGAAAGTTCGAATTACTTTTATTATTTTAGCAATTTTATCGACGATTGTT
    TGCTTGTTCTTAGCAGCAATGCATCCAACAGGACCAAACACAGTAACTTTTGAACAGCCA
    TATTTATTCACCCTCAACATCATTATAATGGTATTAGTCGCATTACCTTCACTTGTTTTA
    GCTATATATGATTATATGAGTTTTAGAATTTCTTCTGCTATTTTACAATTTCTAGGGGCT
    ATCTCTTGGTTCTTTTTATCATTGATATTATCGCTCACACAATTTACACCTTTTACATTA
    GCGTCATTTATAACTTCAATTATTTTGTTCACAAGCACAATTATCACATTAGCCATTGGT
    GGTAAGTCTGTTGAAAAGAATGATTCCCCTTAA
    60
    120
    180
    240
    300
    360
    393

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0368 [new locus tag: NWMN_RS02085 ]
  • symbol: NWMN_0368
  • description: hypothetical protein
  • length: 130
  • theoretical pI: 8.48433
  • theoretical MW: 14403.4
  • GRAVY: 1.23769

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismElectron transportcaa(3)-type oxidase, subunit IV (TIGR02229; HMM-score: 14.7)
  • TheSEED:  
    FIG01108271: hypothetical protein 
  • PFAM:
    no clan definedHerpes_LMP1; Herpesvirus latent membrane protein 1 (LMP1) (PF05297; HMM-score: 6)
    GPCR_A (CL0192) Per1; Per1-like family (PF04080; HMM-score: 6)
    no clan definedGaa1; Gaa1-like, GPI transamidase component (PF04114; HMM-score: 5.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide length 26 aa
    • Ymax: 0.354
    • Ymax_pos: 26
    • Cmax: 0.176
    • Cmax_pos: 26
    • Smax: 0.793
    • Smax_pos: 20
    • Smean: 0.667
    • D: 0.476
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIMMKVRITFIILAILSTIVCLFLAAMHPTGPNTVTFEQPYLFTLNIIIMVLVALPSLVLAIYDYMSFRISSAILQFLGAISWFFLSLILSLTQFTPFTLASFITSIILFTSTIITLAIGGKSVEKNDSP

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]