From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0447 [new locus tag: NWMN_RS02545 ]
  • pan locus tag?: SAUPAN002217000
  • symbol: NWMN_0447
  • pan gene symbol?: pstA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0447 [new locus tag: NWMN_RS02545 ]
  • symbol: NWMN_0447
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 510659..510988
  • length: 330
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGAAAATGATTATAGCGATCGTACAAGATCAAGATAGTCAGGAACTTGCAGATCAACTT
    GTTAAAAATAACTTTAGAGCAACAAAATTGGCAACAACAGGTGGGTTTTTAAGAGCGGGT
    AATACAACATTCTTATGTGGTGTCAATGATGACCGTGTAGATGAAATATTGTCTGTGATT
    AATCAAACGTGTGGTAATAGAGAACAGTTGGTTTCACCTATTACACCTATGGGAGGCAGT
    GCGGATTCGTACATTCCATATCCAGTTGAAGTTGAAGTTGGCGGTGCTACTGTATTTGTT
    ATGCCAGTTGATGCATTCCATCAATTTTAA
    60
    120
    180
    240
    300
    330

Protein[edit source | edit]

Protein Data Bank: 4WK1
Protein Data Bank: 4WK3
Protein Data Bank: 4D3G
Protein Data Bank: 4D3H

General[edit source | edit]

  • locus tag: NWMN_0447 [new locus tag: NWMN_RS02545 ]
  • symbol: NWMN_0447
  • description: hypothetical protein
  • length: 109
  • theoretical pI: 4.21092
  • theoretical MW: 11838.4
  • GRAVY: 0.0422018

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    CBSS-393133.3.peg.2787 protein from nitrogen regulatory protein P-II (GLNB) family, ortholog YAAQ B. subtilis 
  • PFAM:
    GlnB-like (CL0089) CdAMP_rec; Cyclic-di-AMP receptor (PF06153; HMM-score: 183.4)
    P-II; Nitrogen regulatory protein P-II (PF00543; HMM-score: 12.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.151
    • Ymax_pos: 18
    • Cmax: 0.137
    • Cmax_pos: 18
    • Smax: 0.26
    • Smax_pos: 36
    • Smean: 0.14
    • D: 0.147
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFLCGVNDDRVDEILSVINQTCGNREQLVSPITPMGGSADSYIPYPVEVEVGGATVFVMPVDAFHQF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Rebecca M Corrigan, Ivan Campeotto, Tharshika Jeganathan, Kevin G Roelofs, Vincent T Lee, Angelika Gründling
Systematic identification of conserved bacterial c-di-AMP receptor proteins.
Proc. Natl. Acad. Sci. U.S.A.: 2013, 110(22);9084-9
[PubMed:23671116] [WorldCat.org] [DOI] (I p)