From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0568
  • pan locus tag?: SAUPAN002452000
  • symbol: NWMN_0568
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0568
  • symbol: NWMN_0568
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 650668..651030
  • length: 363
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    GTGGAGACATTGCTTTGTGAAACTGAAAATATTAATAAGAATCCCAAATATAGAATTATC
    AAATACAAAGATGAATATTTGATGATTGATTTAGTAAGTATATGGTTAGCACTCTTTTTC
    CCAATGATTAATTGGCTGATTCCAAAAAAGTACGTCAAAATCAGCGAAAAAGATTTTGAA
    ACTTTAAACATTGTGAAGACAGCTAAAATCAATTCTTTTTGGCCAGTGGCAGGAAGTACG
    GTCTTATTTGGTGTTATGTTAAGAAGGTATTCCCATTTATTTATCGTTAAATATGAATAT
    AGTATAGTAATTTTAATTTGTTGCATCATAATACTAGGTATTTTTCTGTTTTTTTATATT
    TAA
    60
    120
    180
    240
    300
    360
    363

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0568
  • symbol: NWMN_0568
  • description: hypothetical protein
  • length: 120
  • theoretical pI: 9.07199
  • theoretical MW: 14318.2
  • GRAVY: 0.611667

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    tandem five-TM protein (TIGR01218; HMM-score: 95.5)
  • TheSEED:  
    repetative hypothetical protein , fig|282458.1.peg.574 homolog 
  • PFAM:
    no clan definedDUF443; Protein of unknown function (DUF443) (PF04276; HMM-score: 118.1)
    DUF5357; Family of unknown function (DUF5357) (PF17310; HMM-score: 14.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.109
    • Ymax_pos: 14
    • Cmax: 0.125
    • Cmax_pos: 55
    • Smax: 0.143
    • Smax_pos: 6
    • Smean: 0.116
    • D: 0.112
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • METLLCETENINKNPKYRIIKYKDEYLMIDLVSIWLALFFPMINWLIPKKYVKISEKDFETLNIVKTAKINSFWPVAGSTVLFGVMLRRYSHLFIVKYEYSIVILICCIIILGIFLFFYI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]