From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0649 [new locus tag: NWMN_RS03685 ]
  • pan locus tag?: SAUPAN002564000
  • symbol: NWMN_0649
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0649 [new locus tag: NWMN_RS03685 ]
  • symbol: NWMN_0649
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 730351..730917
  • length: 567
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAACGAATCGCAGTTTATTGTGGTGCAAGCAAAGGTCATGACCCTTCATATGTACAA
    AAAGCATACGATTTAGGTAAATATTTTGCTGAACAAGGTTATGAATTAGTATTTGGTGCA
    GGGTCAATTGGCATTATGGGTGCCATTCAAGATGGTGTATTAGATCATGGCGGCAAAGCT
    ATTGGCGTCATGCCTAAAATGTTAGATGAACATGAAATCACAAGCCAACGTTTAACTGAA
    TTAATTTTAGTTGATTCTATGCATGAACGTAAAAATAAAATGGCAGAACTTGCAGATGCA
    TTTGTCATGGCTCCTGGTGGCGCAGGTTCACTAGAAGAATTTTTCGAAATGTATAGTTGG
    GCTCAAATAGGTATCCATGAAAAGCCTATTGCCATTTATAATATTAATGGCTTTTTCAAT
    CCACTACAAACAATGATTGACCATATGATTGAGGAAGGTTTTATTGATCCTAAGTATCGT
    GCTCTTGCACCGTTATGCGACACTAAGGAATCATTAATTGAATCAATATTAAATTTCAAA
    CCTCTGGGTACTCGTTCATACGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    567

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0649 [new locus tag: NWMN_RS03685 ]
  • symbol: NWMN_0649
  • description: hypothetical protein
  • length: 188
  • theoretical pI: 4.89275
  • theoretical MW: 20888.9
  • GRAVY: -0.114894

Function[edit source | edit]

  • reaction:
    EC 3.2.2.n1?  ExPASy
    Cytokinin riboside 5'-monophosphate phosphoribohydrolaseA cytokinin riboside 5'-phosphate + H2O = a cytokinin + D-ribose 5'-phosphateN6-(Delta2-isopentenyl)-adenosine 5'-phosphate + H2O = N6-(dimethylallyl)adenine + D-ribose 5'-phosphateTrans-zeatin riboside phosphate + H2O = trans-zeatin + D-ribose 5'-phosphate
  • TIGRFAM:
    Hypothetical proteinsConservedTIGR00730 family protein (TIGR00730; HMM-score: 197.5)
    Hypothetical proteinsConservedTIGR00725 family protein (TIGR00725; HMM-score: 37.6)
    Cellular processesCellular processesDNA transformationDNA protecting protein DprA (TIGR00732; HMM-score: 13)
    gliding motility-associated lipoprotein GldK (TIGR03525; HMM-score: 12.6)
  • TheSEED:  
    Lysine decarboxylase family 
  • PFAM:
    DprA (CL0349) Lysine_decarbox; Possible lysine decarboxylase (PF03641; HMM-score: 151.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.111
    • Ymax_pos: 23
    • Cmax: 0.142
    • Cmax_pos: 23
    • Smax: 0.205
    • Smax_pos: 1
    • Smean: 0.095
    • D: 0.105
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKRIAVYCGASKGHDPSYVQKAYDLGKYFAEQGYELVFGAGSIGIMGAIQDGVLDHGGKAIGVMPKMLDEHEITSQRLTELILVDSMHERKNKMAELADAFVMAPGGAGSLEEFFEMYSWAQIGIHEKPIAIYNINGFFNPLQTMIDHMIEEGFIDPKYRALAPLCDTKESLIESILNFKPLGTRSYD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: SigB [1] other strains
    SigB (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]