From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0717 [new locus tag: NWMN_RS04055 ]
  • pan locus tag?: SAUPAN002655000
  • symbol: NWMN_0717
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0717 [new locus tag: NWMN_RS04055 ]
  • symbol: NWMN_0717
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 803094..803735
  • length: 642
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGACACAAAATATCATTACTGTTAAAAAAGAACACATTATTGAAAATGTGATTAGTAAA
    TCAAGATTCATTGCTCATATCAAACCTGTTCAAAATGAAGATGAAGCTAAAGCATTTATT
    GCTGCAATAAAAAAAGAACATAAAGATGCCACTCATAATTGTTCTGCATATACTATTGGA
    CCTGAAATGAATATTCAAAAAGCGAATGATGATGGTGAACCGACAGGAACTGCCGGTGTC
    CCAATGTTAGACATATTAAAAAAGCTCGATGTTCATAATGCGTGTGTCGTAGTAACAAGA
    TATTTTGGTGGTATTAAATTAGGTGGTGGCGGTTTAATTCGCGCCTATAGCGGTGCTGTT
    AGAGACGTCATTTATGATATCGGGCGTGTCGAACTACGAGAAGCAGTACCATGTATAGTA
    ACACTGAATTATGATCAAACTGGTAAATTTGAATATGAATTAGCTTCAACTCATTTTATG
    TTAAGAAACCAAACTTACACTGATAAGGTAAGCTACTATATCGATGTCGTTAAAAGTGAC
    TATGAAGCGTTTATTAACTTTTTAAATCAAATGACTGCAGGAAATTTCGATTTGACTGAA
    GAAACTCCAAAGCAGTTACCTTTCGATATACCAACTGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    642

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0717 [new locus tag: NWMN_RS04055 ]
  • symbol: NWMN_0717
  • description: hypothetical protein
  • length: 213
  • theoretical pI: 5.62218
  • theoretical MW: 23868
  • GRAVY: -0.260563

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionGeneraluncharacterized protein, YigZ family (TIGR00257; HMM-score: 192.6)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, PigmentsTetrapyrrolesCPO analysis FIG000605: protein co-occurring with transport systems (COG1739) 
  • PFAM:
    S5 (CL0329) UPF0029; Uncharacterized protein family UPF0029 (PF01205; HMM-score: 115.6)
    EF-G_C (CL0437) DUF1949; Domain of unknown function (DUF1949) (PF09186; HMM-score: 48.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.141
    • Ymax_pos: 14
    • Cmax: 0.129
    • Cmax_pos: 33
    • Smax: 0.28
    • Smax_pos: 9
    • Smean: 0.197
    • D: 0.163
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTQNIITVKKEHIIENVISKSRFIAHIKPVQNEDEAKAFIAAIKKEHKDATHNCSAYTIGPEMNIQKANDDGEPTGTAGVPMLDILKKLDVHNACVVVTRYFGGIKLGGGGLIRAYSGAVRDVIYDIGRVELREAVPCIVTLNYDQTGKFEYELASTHFMLRNQTYTDKVSYYIDVVKSDYEAFINFLNQMTAGNFDLTEETPKQLPFDIPTE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_0717 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]