From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0720 [new locus tag: NWMN_RS04070 ]
  • pan locus tag?: SAUPAN002660000
  • symbol: NWMN_0720
  • pan gene symbol?: comFC
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0720 [new locus tag: NWMN_RS04070 ]
  • symbol: NWMN_0720
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 806184..806858
  • length: 675
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAATAATTGTTTGAGTTGTGGTGCTAAGTTATATGAAAATATAACCATTTATAATTTG
    TTCAAGAAACCTAATAGATTATGTGACAGATGCAAAGAGAATTGGGACAATATTAAACTT
    GATATTAAAGCAAGGCGATGTTCAAGGTGCTTAAAACACTTAAATCAAGATGAAGCGTAT
    TGTTTAGACTGCAAGTTTCTATCGGCACACTTTAATTTAATGGAACAATTATATTGTCAA
    TTTCAATATGACGGTTTAATGAAAGAGATGATACATCAGTATAAATTTTTGAAAGACTAT
    TATTTATGTGAATTATTGGCACATTTGATTGAAATACCACAAACATCTTATGACTATATT
    GTGCCAATTCCTTCTTCGCCGGCACATGATTTATCTAGAACATTTAACCCGGTAGAAGCA
    GTACTAAAAGCTAAAGGGATTCGCTTTGATAAGATTTTAAAGATGTCAAATAGACCAAAA
    CAGTCTCATTTAACTAAGAAAGAGCGTCTGGCAGATGAAAATCCATTTATTATTGATACG
    GAATTAGATTTAAATGGTAAGGAAATATTACTCGTTGACGATATTTATACAACTGGATTA
    ACAATTCATCGTGCAGGGTGTAAATTATATGCTAAAAATATCAGAAAATTCAAAGTGTTT
    GCGTTTGCACGATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    675

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0720 [new locus tag: NWMN_RS04070 ]
  • symbol: NWMN_0720
  • description: hypothetical protein
  • length: 224
  • theoretical pI: 8.7123
  • theoretical MW: 26347.6
  • GRAVY: -0.372768

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesDNA transformationcomF family protein (TIGR00201; HMM-score: 80.7)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisribose-phosphate diphosphokinase (TIGR01251; EC 2.7.6.1; HMM-score: 24.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotideshypoxanthine phosphoribosyltransferase (TIGR01203; EC 2.4.2.8; HMM-score: 22.2)
    MetabolismAmino acid biosynthesisHistidine familyhistidinol-phosphatase (TIGR01261; EC 3.1.3.15; HMM-score: 13.4)
  • TheSEED:  
    DNA MetabolismDNA uptake, competenceGram Positive Competence ComF operon protein C 
    DNA uptake, competenceLate competence ComF operon protein C 
  • PFAM:
    PRTase-like (CL0533) Pribosyltran; Phosphoribosyl transferase domain (PF00156; HMM-score: 22.4)
    Zn_Beta_Ribbon (CL0167) DZR; Double zinc ribbon (PF12773; HMM-score: 15.8)
    PRTase-like (CL0533) PRTase_3; PRTase ComF-like (PF15610; HMM-score: 14.5)
    Zn_Beta_Ribbon (CL0167) zinc_ribbon_15; zinc-ribbon family (PF17032; HMM-score: 10.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.143
    • Ymax_pos: 11
    • Cmax: 0.119
    • Cmax_pos: 23
    • Smax: 0.243
    • Smax_pos: 1
    • Smean: 0.194
    • D: 0.163
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNNCLSCGAKLYENITIYNLFKKPNRLCDRCKENWDNIKLDIKARRCSRCLKHLNQDEAYCLDCKFLSAHFNLMEQLYCQFQYDGLMKEMIHQYKFLKDYYLCELLAHLIEIPQTSYDYIVPIPSSPAHDLSRTFNPVEAVLKAKGIRFDKILKMSNRPKQSHLTKKERLADENPFIIDTELDLNGKEILLVDDIYTTGLTIHRAGCKLYAKNIRKFKVFAFAR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]