From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0730 [new locus tag: NWMN_RS04135 ]
  • pan locus tag?: SAUPAN002681000
  • symbol: NWMN_0730
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0730 [new locus tag: NWMN_RS04135 ]
  • symbol: NWMN_0730
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 821721..822206
  • length: 486
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    TTGAGGAAATTTTTATCAAAAACACATCATCATACAAACCCTTTATGGCGTGTATACCGT
    CTTGTTAAATTTTCGAAAGTTTTTAAGAATGTAATTATCATTGAATTTTCGAAATTTATT
    CCAAGTATGGTACTGAAAAGACATATATATAAACAACTTTTAAATATTAATATCGGTAAT
    CAATCGTCGATAGCTTATAAAGTAATGTTAGATATTTTTTACCCAGAACTGATTACGATT
    GGTAGTAACAGTGTTATTGGTTACAATGTAACAATTTTGACGCATGAAGCATTAGTTGAT
    GAATTTCGTTATGGACCAGTGACGATAGGATCTAACACTTTGATTGGTGCAAATGCTACC
    ATTTTACCCGGTATAACGATTGGTGACAATGTAAAAGTTGCAGCTGGTACGGTTGTTTCA
    AAAGATATACCGGATAATGGATTTGCATATGGCAACCCTATGTATATAAAAATGATTAGG
    AGGTGA
    60
    120
    180
    240
    300
    360
    420
    480
    486

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0730 [new locus tag: NWMN_RS04135 ]
  • symbol: NWMN_0730
  • description: hypothetical protein
  • length: 161
  • theoretical pI: 10.4217
  • theoretical MW: 18186.3
  • GRAVY: 0.165839

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family (TIGR03570; HMM-score: 58.6)
    MetabolismAmino acid biosynthesisSerine familyserine O-acetyltransferase (TIGR01172; EC 2.3.1.30; HMM-score: 49.7)
    2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (TIGR03532; EC 2.3.1.89; HMM-score: 46.2)
    colanic acid biosynthesis acetyltransferase WcaB (TIGR04016; EC 2.3.1.-; HMM-score: 45.7)
    non-ribosomal peptide synthetase terminal domain of unknown function (TIGR02353; HMM-score: 42.6)
    phosphonate metabolim protein, transferase hexapeptide repeat family (TIGR03308; HMM-score: 38.4)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesUDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD (TIGR01853; EC 2.3.1.191; HMM-score: 33.9)
    colanic acid biosynthesis acetyltransferase WcaF (TIGR04008; EC 2.3.1.-; HMM-score: 32.9)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 29.9)
    Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 29.9)
    MetabolismCentral intermediary metabolismAmino sugarsUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 29.9)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesacyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase (TIGR01852; EC 2.3.1.129; HMM-score: 19.3)
    UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR03992; EC 2.3.1.157,2.7.7.23; HMM-score: 18)
    MetabolismEnergy metabolismOtherphenylacetic acid degradation protein PaaY (TIGR02287; HMM-score: 16.4)
    2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (TIGR03535; EC 2.3.1.117; HMM-score: 15.7)
    2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (TIGR03536; EC 2.3.1.117; HMM-score: 13.9)
    glucose-1-phosphate thymidylyltransferase (TIGR01208; EC 2.7.7.24; HMM-score: 12.6)
  • TheSEED:  
    Putative acetyltransferase YvoF 
  • PFAM:
    HEXAPEP (CL0536) Hexapep_2; Hexapeptide repeat of succinyl-transferase (PF14602; HMM-score: 54)
    Hexapep; Bacterial transferase hexapeptide (six repeats) (PF00132; HMM-score: 49.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.162
    • Ymax_pos: 12
    • Cmax: 0.108
    • Cmax_pos: 65
    • Smax: 0.336
    • Smax_pos: 10
    • Smean: 0.258
    • D: 0.199
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRKFLSKTHHHTNPLWRVYRLVKFSKVFKNVIIIEFSKFIPSMVLKRHIYKQLLNINIGNQSSIAYKVMLDIFYPELITIGSNSVIGYNVTILTHEALVDEFRYGPVTIGSNTLIGANATILPGITIGDNVKVAAGTVVSKDIPDNGFAYGNPMYIKMIRR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]