From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1018 [new locus tag: NWMN_RS05770 ]
  • pan locus tag?: SAUPAN001685000
  • symbol: NWMN_1018
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1018 [new locus tag: NWMN_RS05770 ]
  • symbol: NWMN_1018
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1120119..1120733
  • length: 615
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGGATATCCAAGAGAAGTTAAAACTCAAATTACAGTTTTTTGCTGAAGAATCAGATGGA
    GATAATGGAAAATCAAAAGATAACAACGATGATGAAGGCAAAGACAAACAAGACAAAAAG
    ACTAATTCAGAAGAAGAAATCGAAAAAAGACTACAAGAAGAATATAACAAGCGTCTTAAA
    GAAGAATTAAGTCGTCGTATGAAGCAGAAAGAAAAAGAGAAACAAGAAGCTGTTGATGAA
    GCTAAACGATTAGCAAAAATGAACAAAGATCAAATCGCTGAATATGAACGCGAACAAATG
    GAAAAAGAGCTGGAACAATTACGTTCAGAAAAACAATTAAACGAAATGCGTTCAGAAGCA
    CGAAAAATGTTGAGTGAAGCGGAAGTTGATTCATCAGATGAGGTTGTCAATTTGGTTGTA
    ACTGACACTGCTGAACAAACCAAATCGAACGTTGAAGCTTTTTCTAATGCAGTAAAAAAA
    GCGGTTAATGAAGCGGTTAAGGTTAACGCTAGACAATCGCCATTGACTGGTGGAGATTCA
    TTTAATCACTCGACTAAAAATAAACCGCAAAACTTAGCTGAAATAGCTAGACAAAAAAGA
    ATTATTAAAAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    615

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1018 [new locus tag: NWMN_RS05770 ]
  • symbol: NWMN_1018
  • description: hypothetical protein
  • length: 204
  • theoretical pI: 5.19987
  • theoretical MW: 23664.2
  • GRAVY: -1.40882

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundsferrous iron transport protein B (TIGR00437; HMM-score: 2.9)
  • TheSEED:  
    Phages, Prophages, Transposable elementsPhages, ProphagesPhage head and packaging Phage capsid and scaffold 
  • PFAM:
    no clan definedDUF4355; Domain of unknown function (DUF4355) (PF14265; HMM-score: 94.8)
    Peptidase_MA (CL0126) DUF45; Protein of unknown function DUF45 (PF01863; HMM-score: 8.5)
    no clan definedTfb2; Transcription factor Tfb2 (PF03849; HMM-score: 7.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.129
    • Ymax_pos: 26
    • Cmax: 0.111
    • Cmax_pos: 26
    • Smax: 0.21
    • Smax_pos: 23
    • Smean: 0.126
    • D: 0.128
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MDIQEKLKLKLQFFAEESDGDNGKSKDNNDDEGKDKQDKKTNSEEEIEKRLQEEYNKRLKEELSRRMKQKEKEKQEAVDEAKRLAKMNKDQIAEYEREQMEKELEQLRSEKQLNEMRSEARKMLSEAEVDSSDEVVNLVVTDTAEQTKSNVEAFSNAVKKAVNEAVKVNARQSPLTGGDSFNHSTKNKPQNLAEIARQKRIIKN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]