From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1192 [new locus tag: NWMN_RS06715 ]
  • pan locus tag?: SAUPAN003585000
  • symbol: pgsA
  • pan gene symbol?: pgsA
  • synonym:
  • product: CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1192 [new locus tag: NWMN_RS06715 ]
  • symbol: pgsA
  • product: CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 1314058..1314636
  • length: 579
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAATATTCCGAACCAGATTACGGTTTTTAGAGTAGTGTTAATACCAGTTTTTATATTG
    TTTGCGTTAGTTGATTTTGGATTTGGCAATGTGTCATTTCTAGGAGGATATGAAATAAGA
    ATTGAGTTATTAATCAGTGGTTTTATTTTTATATTGGCTTCCCTTAGCGATTTTGTTGAT
    GGTTATTTAGCTAGAAAATGGAATTTAGTTACAAATATGGGGAAATTTTTGGATCCATTA
    GCGGATAAATTATTAGTTGCAAGTGCTTTAATGTACTTTGTGCAACTAGGACTAACAAAT
    TCTGTAGTAGCAATCATTATTATTGCCAGAGAATTTGCCGTAACTGGTTTACGTTTACTA
    CAAATTGAACAAGGATTCGTAAGTGCAGCTGGTCAATTAGGTAAAATTAAAACAGCAGTT
    ACTATGGTAGCAATTACTTGGTTGTTATTAGGTGATCCATTGGCAACATTGATTGGTTTG
    TCATTAGGACAAATTTTATTATACATTGGCGTTATTTTTACTATCTTATCTGGTATTGAA
    TACTTTTATAAAGGTAGAGATGTTTTTAAACAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    579

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1192 [new locus tag: NWMN_RS06715 ]
  • symbol: PgsA
  • description: CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase
  • length: 192
  • theoretical pI: 9.3375
  • theoretical MW: 21130.2
  • GRAVY: 0.977083

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismFatty acid and phospholipid metabolismBiosynthesisCDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (TIGR00560; EC 2.7.8.5; HMM-score: 188.4)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisCDP-diacylglycerol-serine O-phosphatidyltransferase (TIGR00473; EC 2.7.8.8; HMM-score: 34)
  • TheSEED:  
    Fatty Acids, Lipids, and IsoprenoidsPhospholipidsGlycerolipid and Glycerophospholipid Metabolism in Bacteria CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 
    CBSS-257314.1.peg.676 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 
  • PFAM:
    no clan definedCDP-OH_P_transf; CDP-alcohol phosphatidyltransferase (PF01066; HMM-score: 60.1)
    Holin-II (CL0563) Phage_holin_2_3; Bacteriophage holin family HP1 (PF16080; HMM-score: 13.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.134
    • Ymax_pos: 13
    • Cmax: 0.136
    • Cmax_pos: 35
    • Smax: 0.251
    • Smax_pos: 5
    • Smean: 0.184
    • D: 0.153
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNIPNQITVFRVVLIPVFILFALVDFGFGNVSFLGGYEIRIELLISGFIFILASLSDFVDGYLARKWNLVTNMGKFLDPLADKLLVASALMYFVQLGLTNSVVAIIIIAREFAVTGLRLLQIEQGFVSAAGQLGKIKTAVTMVAITWLLLGDPLATLIGLSLGQILLYIGVIFTILSGIEYFYKGRDVFKQK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]