From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1283 [new locus tag: NWMN_RS07230 ]
  • pan locus tag?: SAUPAN003766000
  • symbol: trpF
  • pan gene symbol?: trpF
  • synonym:
  • product: N-(5'-phosphoribosyl)anthranilate isomerase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1283 [new locus tag: NWMN_RS07230 ]
  • symbol: trpF
  • product: N-(5'-phosphoribosyl)anthranilate isomerase
  • replicon: chromosome
  • strand: +
  • coordinates: 1414146..1414781
  • length: 636
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGATGAAATTGAAATTTTGTGGCTTTACATCAATAAAGGATGTTACAGCGGCCAGTCAA
    TTACCTATTGATGCGATAGGTTTCATCCATTATGAAAAAAGTAAAAGGCATCAAACAATT
    ACCCAAATAAAAAAGTTAGCGTCTGCTGTTCCAAATCATATCGATAAAGTATGTGTCATG
    GTAAATCCTGATTTAACAACAATTGAACACGTATTAAGCAATACGTCAATTAACACAATA
    CAGTTACACGGCACAGAATCTATTGATTTTATACAGGAAATTAAAAAGAAATATTCAAGC
    ATTAAAATCACTAAAGCTTTAGCTGCAGATGAAAACATAATCCAAAACATAAATAAATAT
    AAAGGGTTCGTAGATTTATTTATTATCGACACACCCTCAGTGTCGTATGGTGGTACCGGT
    CAAACATATGACTGGACTATTTTGAAGCACATAAAAGACATACCTTATTTGATAGCAGGA
    GGCATTAACTCTGAAAATATTCAAACAGTTAATCAACTTAAATTATCACATCAAGGTTAT
    GATCTTGCATCAGGTATAGAAGTAAATGGGCGAAAAGATATAGAAAAAATGACAGCAATT
    GTAAATATTGTGAAAGGAGATAGAGACAATGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    636

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1283 [new locus tag: NWMN_RS07230 ]
  • symbol: TrpF
  • description: N-(5'-phosphoribosyl)anthranilate isomerase
  • length: 211
  • theoretical pI: 8.22155
  • theoretical MW: 23519.9
  • GRAVY: -0.191469

Function[edit source | edit]

  • reaction:
    EC 5.3.1.24?  ExPASy
    Phosphoribosylanthranilate isomeraseN-(5-phospho-beta-D-ribosyl)anthranilate = 1-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5-phosphate
  • TIGRFAM:
    His-Xaa-Ser system putative quinone modification maturase (TIGR03981; HMM-score: 12.3)
  • TheSEED:  
    Amino Acids and DerivativesAromatic amino acids and derivativesTryptophan synthesis Phosphoribosylanthranilate isomerase (EC 5.3.1.24) 
    Cofactors, Vitamins, Prosthetic Groups, PigmentsFolate and pterinesFolate Biosynthesis Phosphoribosylanthranilate isomerase (EC 5.3.1.24) 
  • PFAM:
    TIM_barrel (CL0036) PRAI; N-(5'phosphoribosyl)anthranilate (PRA) isomerase (PF00697; HMM-score: 130.7)
    PIN (CL0280) 5_3_exonuc_N; 5'-3' exonuclease, N-terminal resolvase-like domain (PF02739; HMM-score: 14.7)
    no clan definedMer2; Mer2 (PF09074; HMM-score: 12.8)
    DUF1995; Domain of unknown function (DUF1995) (PF09353; HMM-score: 12.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 0.67
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.336
    • Ymax_pos: 18
    • Cmax: 0.246
    • Cmax_pos: 18
    • Smax: 0.715
    • Smax_pos: 1
    • Smean: 0.514
    • D: 0.406
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MMKLKFCGFTSIKDVTAASQLPIDAIGFIHYEKSKRHQTITQIKKLASAVPNHIDKVCVMVNPDLTTIEHVLSNTSINTIQLHGTESIDFIQEIKKKYSSIKITKALAADENIIQNINKYKGFVDLFIIDTPSVSYGGTGQTYDWTILKHIKDIPYLIAGGINSENIQTVNQLKLSHQGYDLASGIEVNGRKDIEKMTAIVNIVKGDRDNE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolism  RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]