From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1422 [new locus tag: NWMN_RS08030 ]
  • pan locus tag?: SAUPAN004071000
  • symbol: NWMN_1422
  • pan gene symbol?: bfmBAB
  • synonym:
  • product: 2-oxoisovalerate dehydrogenase, E1 component, beta subunit

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1422 [new locus tag: NWMN_RS08030 ]
  • symbol: NWMN_1422
  • product: 2-oxoisovalerate dehydrogenase, E1 component, beta subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 1592723..1593706
  • length: 984
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    ATGGCTAAATTATCTTATTTAGAGGCGATACGCCAGGCACAAGACTTAGCATTACAACAA
    AATAAAGATGTGTTTATTCTTGGTGAAGATGTTGGTAGAAAAGGTGGCGTATTTGGTACT
    ACTCAAGGACTGCAACAAAAATATGGTGAAGACAGAGTTATCGATACGCCATTAGCTGAG
    TCAAATATTGTTGGAACTGCCATTGGTGCAGCTATGGTAGGTAAAAGACCAATTGCAGAA
    ATTCAATTTGCAGATTTTATTTTACCTGCGACAAATCAAATTATTAGTGAAGCTGCGAAA
    ATGCGTTATCGTTCAAATAATGATTGGCAATGCCCATTAACGATTCGTGCACCATTTGGT
    GGCGGTGTTCACGGAGGACTATATCATTCACAAAGTATTGAAAGTATATTTGCTTCATCG
    CCAGGTTTAACAATTGTTATTCCTTCCACACCGTATGATGCTAAAGGGCTTTTATTATCA
    TCTATCGAATCAAATGATCCAGTATTGTACTTTGAGCATAAAAAAGCTTATCGTTTCTTA
    AAGGAAGAAGTGCCAGAAGAATATTACACTGTACCTTTAGGAAAAGCAGATGTGAAACGT
    GAAGGTGAAGATTTAACAGTATTTTGTTATGGATTAATGGTCAATTATTGTTTACAAGCA
    GCGGATATTTTAGCTGCAGACGGTATCAATGTTGAAGTCGTTGATTTACGAACTGTTTAT
    CCATTAGATAAAGAAACAATTATTGATCGTGCTAAACATACAGGTAAAGTTTTACTTGTA
    ACTGAAGATAATTTAGAAGGTAGTATTATGTCAGAAGTGTCAGCGATTATTGCAGAGCAT
    TGCTTGTTCGATTTAGATGCACCAATCATGCGTTTAGCTGCTCCAGATGTACCATCTATG
    CCATTTTCTCCTGTATTAGAAAATGAAATTATGATGAATCCAGAAAAAATCTTAAATAAA
    ATGCGTGAATTAGCAGAATTCTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    984

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1422 [new locus tag: NWMN_RS08030 ]
  • symbol: NWMN_1422
  • description: 2-oxoisovalerate dehydrogenase, E1 component, beta subunit
  • length: 327
  • theoretical pI: 4.52444
  • theoretical MW: 36061.2
  • GRAVY: -0.0443425

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOther1-deoxy-D-xylulose-5-phosphate synthase (TIGR00204; EC 2.2.1.7; HMM-score: 76.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiamine1-deoxy-D-xylulose-5-phosphate synthase (TIGR00204; EC 2.2.1.7; HMM-score: 76.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPyridoxine1-deoxy-D-xylulose-5-phosphate synthase (TIGR00204; EC 2.2.1.7; HMM-score: 76.4)
    2-oxoacid:acceptor oxidoreductase, alpha subunit (TIGR03710; HMM-score: 23.1)
    indolepyruvate ferredoxin oxidoreductase, alpha subunit (TIGR03336; EC 1.2.7.8; HMM-score: 20.7)
  • TheSEED:  
    Amino Acids and DerivativesBranched-chain amino acidsIsoleucine degradation Branched-chain alpha-keto acid dehydrogenase, E1 component, beta subunit (EC 1.2.4.4) 
    Branched-chain amino acidsValine degradation Branched-chain alpha-keto acid dehydrogenase, E1 component, beta subunit (EC 1.2.4.4) 
    CarbohydratesCentral carbohydrate metabolismDehydrogenase complexes Branched-chain alpha-keto acid dehydrogenase, E1 component, beta subunit (EC 1.2.4.4) 
  • PFAM:
    THDP-binding (CL0254) Transket_pyr; Transketolase, pyrimidine binding domain (PF02779; HMM-score: 155.6)
    TKC_like (CL0591) Transketolase_C; Transketolase, C-terminal domain (PF02780; HMM-score: 135.5)
    PFOR_II; Pyruvate:ferredoxin oxidoreductase core domain II (PF17147; HMM-score: 23.5)
    no clan definedDUF2795; Protein of unknown function (DUF2795) (PF11387; HMM-score: 12.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_2534(arcA)arginine deiminase  [1] (data from MRSA252)
    NWMN_1114(carB)carbamoyl phosphate synthase large subunit  [1] (data from MRSA252)
    NWMN_1587(citC)isocitrate dehydrogenase  [1] (data from MRSA252)
    NWMN_1096(ftsZ)cell division protein FtsZ  [1] (data from MRSA252)
    NWMN_0509(fus)elongation factor G  [1] (data from MRSA252)
    NWMN_1580(gapB)glyceraldehyde 3-phosphate dehydrogenase 2  [1] (data from MRSA252)
    NWMN_1838(gatA)aspartyl/glutamyl-tRNA amidotransferase subunit A  [1] (data from MRSA252)
    NWMN_1837(gatB)aspartyl/glutamyl-tRNA amidotransferase subunit B  [1] (data from MRSA252)
    NWMN_1348(ilvA)threonine dehydratase  [1] (data from MRSA252)
    NWMN_1424(lpdA)dihydrolipoamide dehydrogenase  [1] (data from MRSA252)
    NWMN_2446(mvaS)3-hydroxy-3-methylglutaryl coenzyme A synthase  [1] (data from MRSA252)
    NWMN_2040(pdp)pyrimidine-nucleoside phosphorylase  [1] (data from MRSA252)
    NWMN_0959(phdA)pyruvate dehydrogenase E1 component, alpha subunit  [1] (data from MRSA252)
    NWMN_2438(poxB)pyruvate oxidase  [1] (data from MRSA252)
    NWMN_1592(pykA)pyruvate kinase  [1] (data from MRSA252)
    NWMN_0500(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    NWMN_0501(rplJ)50S ribosomal protein L10  [1] (data from MRSA252)
    NWMN_1166(rpsB)30S ribosomal protein S2  [1] (data from MRSA252)
    NWMN_2135(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    NWMN_2138(rpsH)30S ribosomal protein S8  [1] (data from MRSA252)
    NWMN_0785(sufC)FeS assembly ATPase SufC  [1] (data from MRSA252)
    NWMN_0510(tufA)elongation factor Tu  [1] (data from MRSA252)
    NWMN_0641hypothetical protein  [1] (data from MRSA252)
    NWMN_0811hypothetical protein  [1] (data from MRSA252)
    NWMN_0839fumarylacetoacetate hydrolase family protein  [1] (data from MRSA252)
    NWMN_0881enoyl-(acyl carrier protein) reductase  [1] (data from MRSA252)
    NWMN_14212-oxoisovalerate dehydrogenase, E2 component  [1] (data from MRSA252)
    NWMN_14232-oxoisovalerate dehydrogenase, E1 component, alpha subunit  [1] (data from MRSA252)
    NWMN_1604universal stress protein family protein  [1] (data from MRSA252)
    NWMN_2026aldehyde dehydrogenase family protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.109
    • Ymax_pos: 27
    • Cmax: 0.136
    • Cmax_pos: 70
    • Smax: 0.147
    • Smax_pos: 18
    • Smean: 0.098
    • D: 0.105
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAKLSYLEAIRQAQDLALQQNKDVFILGEDVGRKGGVFGTTQGLQQKYGEDRVIDTPLAESNIVGTAIGAAMVGKRPIAEIQFADFILPATNQIISEAAKMRYRSNNDWQCPLTIRAPFGGGVHGGLYHSQSIESIFASSPGLTIVIPSTPYDAKGLLLSSIESNDPVLYFEHKKAYRFLKEEVPEEYYTVPLGKADVKREGEDLTVFCYGLMVNYCLQAADILAADGINVEVVDLRTVYPLDKETIIDRAKHTGKVLLVTEDNLEGSIMSEVSAIIAEHCLFDLDAPIMRLAAPDVPSMPFSPVLENEIMMNPEKILNKMRELAEF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]