From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1610 [new locus tag: NWMN_RS09025 ]
  • pan locus tag?: SAUPAN004368000
  • symbol: NWMN_1610
  • pan gene symbol?: nifZ
  • synonym:
  • product: aminotransferase, class V

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1610 [new locus tag: NWMN_RS09025 ]
  • symbol: NWMN_1610
  • product: aminotransferase, class V
  • replicon: chromosome
  • strand: -
  • coordinates: 1787327..1788466
  • length: 1140
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    TTGATATATCTAGATAATGCGGCAACGACGAAAGCATTTGAAGAAGTGTTAGATACTTAT
    TTAAAAGTAAATCAATCAATGTATTATAATCCGAATAGTCCGCATAAAGCTGGTTTGCAG
    GCAAATCAATTACTACAACAAGCAAAAACCCAAATTAATGCAATGATTAATTCAAAAACA
    AATTATGATGTTGTATTCACTAGTGGTGCAACTGAATCCAATAATCTTGCTTTAAAAGGT
    ATTGCCTATCGTAAATTTGATACAGCGAAGGAAATAATTACATCCGTGTTAGAGCATCCG
    TCCGTATTAGAGGTTGTAAGATATTTGGAAGCACACGAAGGATTTAAAGTTAAATATGTT
    GATGTAAAGAAAGATGGCAGTATTAACTTAGAACACTTCAAAGAATTAATGTCAGACAAA
    GTCGGTTTAGTAACATGTATGTATGTAAATAATGTAACTGGACAAATACAGCCTATTCCA
    CAAATGGCTAAAGTTATAAAAAATTATCCTAAGGCACATTTTCATGTAGATGCGGTTCAA
    GCATTCGGCAAAATTTCAATGGATCTCAATAACATAGATAGTATTAGTTTAAGTGGACAC
    AAGTTTAATGGTTTAAAAGGACAAGGCGTCTTACTTGTAAATCACATTCAAAATGTTGAA
    CCAACTGTCCATGGTGGTGGTCAAGAATATGGCGTTAGAAGTGGAACAGTTAATTTGCCA
    AATGATATTGCAATGGTTAAAGCGATGAAGATAGCTAATGAAAACTTTGAAGCATTGAAT
    GCATTTGTTACTGAGTTAAATAATGACGTCCGTCAATTTTTAAATAAATATCATGGAGTT
    TATATTAATTCTTCAACTTCAGGTTCACCATTCGTTTTAAATATTAGTTTTCCTGGCGTA
    AAAGGTGAAGTATTAGTTAATGCTTTTTCAAAATATGACATTATGATATCTACGACAAGT
    GCTTGTTCATCTAAACGTAATAAATTAAATGAAGTATTGGCTGCAATGGGATTATCAGAC
    AAATCTATTGAAGGTAGTATAAGATTATCATTTGGGGCTACTACAACTAAAGAAGATATA
    GCGAGGTTTAAAGAAATATTTATCATCATTTATGAGGAAATTAAGGAGTTGCTAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1610 [new locus tag: NWMN_RS09025 ]
  • symbol: NWMN_1610
  • description: aminotransferase, class V
  • length: 379
  • theoretical pI: 8.1916
  • theoretical MW: 41991.8
  • GRAVY: -0.156464

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    cysteine desulfurase NifS (TIGR03402; EC 2.8.1.7; HMM-score: 310.8)
    Genetic information processingDNA metabolismRestriction/modificationcysteine desulfurase DndA (TIGR03235; EC 2.8.1.7; HMM-score: 297.6)
    Genetic information processingProtein synthesistRNA and rRNA base modificationcysteine desulfurase IscS (TIGR02006; EC 2.8.1.7; HMM-score: 281.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOthercysteine desulfurase IscS (TIGR02006; EC 2.8.1.7; HMM-score: 281.6)
    cysteine desulfurase, NifS family (TIGR03403; EC 2.8.1.7; HMM-score: 250.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOthercysteine desulfurase, SufS family (TIGR01979; HMM-score: 139)
    Unknown functionEnzymes of unknown specificitycysteine desulfurase family protein (TIGR01977; HMM-score: 132.1)
    Unknown functionEnzymes of unknown specificitycysteine desulfurase family protein (TIGR01976; HMM-score: 86.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOthercysteine desulfurase, catalytic subunit CsdA (TIGR03392; EC 2.8.1.7; HMM-score: 76.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersGlutathione and analogsergothioneine biosynthesis PLP-dependent enzyme EgtE (TIGR04343; EC 4.4.-.-; HMM-score: 43.8)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOthertyrosine decarboxylase MnfA (TIGR03812; EC 4.1.1.25; HMM-score: 28)
    MetabolismCentral intermediary metabolismPhosphorus compounds2-aminoethylphosphonate--pyruvate transaminase (TIGR02326; EC 2.6.1.37; HMM-score: 25.4)
  • TheSEED:  
    Amino Acids and DerivativesAlanine, serine, and glycineAlanine biosynthesis Cysteine desulfurase (EC 2.8.1.7) 
    RNA MetabolismRNA processing and modificationtRNA modification Archaea Cysteine desulfurase (EC 2.8.1.7) 
    Sulfur MetabolismOrganic sulfur assimilationAt5g37530 (CsdL protein family) Cysteine desulfurase (EC 2.8.1.7) 
    CBSS-393130.3.peg.794 Cysteine desulfurase (EC 2.8.1.7) 
    CBSS-84588.1.peg.1247 Cysteine desulfurase (EC 2.8.1.7) 
  • PFAM:
    PLP_aminotran (CL0061) Aminotran_5; Aminotransferase class-V (PF00266; HMM-score: 236.1)
    DegT_DnrJ_EryC1; DegT/DnrJ/EryC1/StrS aminotransferase family (PF01041; HMM-score: 19.8)
    EF_hand (CL0220) EF-hand_1; EF hand (PF00036; HMM-score: 15.8)
    PLP_aminotran (CL0061) Beta_elim_lyase; Beta-eliminating lyase (PF01212; HMM-score: 15.6)
    no clan definedDUF4473; Domain of unknown function (DUF4473) (PF14747; HMM-score: 8.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.131
    • Ymax_pos: 55
    • Cmax: 0.115
    • Cmax_pos: 55
    • Smax: 0.235
    • Smax_pos: 36
    • Smean: 0.134
    • D: 0.132
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHKAGLQANQLLQQAKTQINAMINSKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLEAHEGFKVKYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPKAHFHVDAVQAFGKISMDLNNIDSISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYGVRSGTVNLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYINSSTSGSPFVLNISFPGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTKEDIARFKEIFIIIYEEIKELLK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]