From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1838 [new locus tag: NWMN_RS10565 ]
  • pan locus tag?: SAUPAN004927000
  • symbol: gatA
  • pan gene symbol?: gatA
  • synonym:
  • product: aspartyl/glutamyl-tRNA amidotransferase subunit A

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1838 [new locus tag: NWMN_RS10565 ]
  • symbol: gatA
  • product: aspartyl/glutamyl-tRNA amidotransferase subunit A
  • replicon: chromosome
  • strand: -
  • coordinates: 2046049..2047506
  • length: 1458
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    1441
    ATGAGCATTCGCTACGAATCGGTTGAGAATTTATTAACTTTAATAAAAGACAAAAAAATC
    AAACCATCTGATGTTGTTAAAGATATATATGATGCAATTGAAGAGACTGATCCAACAATT
    AAGTCTTTTCTAGCGCTGGATAAAGAAAATGCAATCAAAAAAGCGCAAGAATTGGATGAA
    TTACAAGCAAAAGATCAAATGGATGGCAAATTATTTGGTATTCCAATGGGTATAAAAGAT
    AACATTATTACAAACGGATTAGAAACAACATGTGCAAGTAAAATGTTAGAAGGTTTTGTG
    CCAATTTACGAATCTACTGTAATGGAAAAACTACATAATGAAAATGCCGTTTTAATCGGT
    AAATTAAATATGGATGAGTTTGCAATGGGTGGTTCAACAGAAACATCTTATTTCAAAAAA
    ACAGTTAACCCATTTGACCATAAAGCAGTGCCAGGTGGTTCATCAGGTGGATCTGCAGCA
    GCAGTTGCAGCTGGCTTAGTACCATTTAGCTTAGGTTCAGACACAGGTGGTTCAATTAGA
    CAACCGGCTGCATATTGTGGCGTTGTCGGTATGAAACCAACATACGGTCGTGTATCTCGA
    TTTGGATTAGTTGCTTTTGCATCTTCATTAGACCAAATTGGTCCATTGACTCGAAATGTA
    AAAGATAATGCAATCGTATTAGAAGCTATTTCTGGTGCAGATGTTAATGACTCTACAAGT
    GCACCAGTTGATGATGTAGACTTTACATCTGAAATTGGTAAAGATATTAAAGGATTAAAA
    GTTGCATTACCTAAAGAATACTTAGGTGAAGGTGTAGCTGATGACGTAAAAGAAGCAGTT
    CAAAACGCTGTAGAAACTTTAAAATCTTTAGGTGCTGTCGTTGAGGAAGTATCATTGCCA
    AATACTAAATTTGGTATTCCATCATATTACGTGATTGCATCATCAGAAGCTTCGTCAAAC
    CTTTCTCGTTTTGACGGAATTCGTTATGGTTATCATTCTAAAGAAGCTCATTCATTAGAA
    GAATTATATAAAATGTCAAGATCTGAAGGTTTCGGTAAAGAAGTAAAACGTCGTATTTTC
    TTAGGTACATTTGCATTAAGTTCAGGTTACTATGATGCTTACTATAAAAAATCTCAAAAA
    GTTAGAACATTGATTAAAAATGACTTTGATAAAGTATTCGAAAATTATGATGTAGTAGTT
    GGTCCAACAGCGCCTACAACTGCGTTTAATTTAGGTGAAGAAATTGATGATCCATTAACA
    ATGTATGCCAATGATTTATTAACAACACCAGTAAACTTAGCTGGATTACCTGGTATTTCT
    GTTCCTTGTGGACAATCAAATGGCCGACCAATCGGTTTACAGTTCATTGGTAAACCATTC
    GATGAAAAAACGTTATATCGTGTCGCTTATCAATATGAAACACAATACAATTTACATGAC
    GTTTATGAAAAATTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1440
    1458

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1838 [new locus tag: NWMN_RS10565 ]
  • symbol: GatA
  • description: aspartyl/glutamyl-tRNA amidotransferase subunit A
  • length: 485
  • theoretical pI: 4.76401
  • theoretical MW: 52820.5
  • GRAVY: -0.234639

Function[edit source | edit]

  • reaction:
    EC 6.3.5.7?  ExPASy
    Glutaminyl-tRNA synthase (glutamine-hydrolyzing)ATP + L-glutamyl-tRNA(Gln) + L-glutamine = ADP + phosphate + L-glutaminyl-tRNA(Gln) + L-glutamate
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA aminoacylationaspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit (TIGR00132; EC 6.3.5.-; HMM-score: 657.8)
    Unknown functionEnzymes of unknown specificityamidohydrolase, AtzE family (TIGR02715; EC 3.-.-.-; HMM-score: 308.5)
    MetabolismCentral intermediary metabolismNitrogen metabolismallophanate hydrolase (TIGR02713; EC 3.5.1.54; HMM-score: 213.7)
  • TheSEED:  
    Protein MetabolismProtein biosynthesistRNA aminoacylation, Glu and Gln Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.7) 
    tRNA aminoacylation, Glu and Gln Aspartyl-tRNA(Asn) amidotransferase subunit A (EC 6.3.5.6) 
  • PFAM:
    no clan definedAmidase; Amidase (PF01425; HMM-score: 526.9)
    Thioredoxin (CL0172) Calsequestrin; Calsequestrin (PF01216; HMM-score: 12.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_2446(mvaS)3-hydroxy-3-methylglutaryl coenzyme A synthase  [1] (data from MRSA252)
    NWMN_0510(tufA)elongation factor Tu  [1] (data from MRSA252)
    NWMN_1604universal stress protein family protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.116
    • Ymax_pos: 23
    • Cmax: 0.112
    • Cmax_pos: 23
    • Smax: 0.145
    • Smax_pos: 19
    • Smean: 0.117
    • D: 0.116
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSIRYESVENLLTLIKDKKIKPSDVVKDIYDAIEETDPTIKSFLALDKENAIKKAQELDELQAKDQMDGKLFGIPMGIKDNIITNGLETTCASKMLEGFVPIYESTVMEKLHNENAVLIGKLNMDEFAMGGSTETSYFKKTVNPFDHKAVPGGSSGGSAAAVAAGLVPFSLGSDTGGSIRQPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPLTRNVKDNAIVLEAISGADVNDSTSAPVDDVDFTSEIGKDIKGLKVALPKEYLGEGVADDVKEAVQNAVETLKSLGAVVEEVSLPNTKFGIPSYYVIASSEASSNLSRFDGIRYGYHSKEAHSLEELYKMSRSEGFGKEVKRRIFLGTFALSSGYYDAYYKKSQKVRTLIKNDFDKVFENYDVVVGPTAPTTAFNLGEEIDDPLTMYANDLLTTPVNLAGLPGISVPCGQSNGRPIGLQFIGKPFDEKTLYRVAYQYETQYNLHDVYEKL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]