From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1921 [new locus tag: NWMN_RS11085 ]
  • pan locus tag?: SAUPAN005125000
  • symbol: NWMN_1921
  • pan gene symbol?:
  • synonym:
  • product: phage cI-like repressor

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1921 [new locus tag: NWMN_RS11085 ]
  • symbol: NWMN_1921
  • product: phage cI-like repressor
  • replicon: chromosome
  • strand: +
  • coordinates: 2128167..2128880
  • length: 714
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAACAAAGAAAGAAATATTATTATAGCCAAAAACATTAGAAAATTTCTCAACGATTCA
    AATATGTCTCAAAAGAAACTTGCTGAACTCATTAACATAAAACCATCTACTTTAAGCGAT
    TATTTAAATTTACGTTCCAACCCCTCTCACGGCGTTATACAAAGGATAGCTGATGTTTTC
    GAGGTTGGTAAAAGCGACATAGATACTACATACAAAGACGATAACGACATCACTTCCATA
    TACAACAAACTCACACCTCCCCGCCAAGAAAACGTACTTAACTATGCAAATGAACAATTG
    GAAGAACAGAATTCTAAAGGAGATAACGTTGTAGATATTAATTCATATAAACAGGAGAAA
    ACTCCAGTTAACGTCAATGGTTGCGTCTCTGCTGGTGTAGGAGAACGTTTACACGATGAA
    ACGCTATTTACTGAAATGGTTAAAGGACCTATCCCCACACACGATTTAGCGTTAAAAGTA
    AATGGTGATTCTATGGAACCTATGTTTAAAGATGGCGAAATCATATTTGTGGAGAAAACT
    CACAATATAAAGAATGGACAAATTGGTATATTCATCATTGAAGAAGAAGCGTACGTTAAG
    AAAGTCTTTGTTGAAGATGATAGATTGACTCTAGTTTCACTAAATAAAGATTACGACGAT
    CTACACTTTTATAGAAATGAAAGTGTGAGGTTAATTGGAAAAGTTATTTTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    714

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1921 [new locus tag: NWMN_RS11085 ]
  • symbol: NWMN_1921
  • description: phage cI-like repressor
  • length: 237
  • theoretical pI: 5.05491
  • theoretical MW: 27017.4
  • GRAVY: -0.528692

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairrepressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 41.6)
    Signal transductionRegulatory functionsDNA interactionsrepressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 41.6)
    signal peptidase I (TIGR02228; EC 3.4.21.89; HMM-score: 26)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingsignal peptidase I (TIGR02227; EC 3.4.21.89; HMM-score: 24.4)
    Cellular processesCellular processesDetoxificationnickel-type superoxide dismutase maturation protease (TIGR02754; EC 3.4.21.-; HMM-score: 16.7)
    Genetic information processingProtein fateProtein modification and repairnickel-type superoxide dismutase maturation protease (TIGR02754; EC 3.4.21.-; HMM-score: 16.7)
    ParB/RepB/Spo0J family partition protein (TIGR00180; HMM-score: 15.9)
    Genetic information processingMobile and extrachromosomal element functionsOtheraddiction module antidote protein, HigA family (TIGR02607; HMM-score: 15.3)
    Signal transductionRegulatory functionsDNA interactionsaddiction module antidote protein, HigA family (TIGR02607; HMM-score: 15.3)
    Signal transductionRegulatory functionsProtein interactionsaddiction module antidote protein, HigA family (TIGR02607; HMM-score: 15.3)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 12.5)
  • TheSEED:  
    CI-like repressor, phage associated 
  • PFAM:
    Peptidase_SF (CL0299) Peptidase_S24; Peptidase S24-like (PF00717; HMM-score: 60)
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 42.8)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 29.3)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 24.2)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 21.8)
    HNF-1_N; Hepatocyte nuclear factor 1 (HNF-1), N terminus (PF04814; HMM-score: 20.7)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 16.9)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 14.9)
    PELOTA (CL0101) TSNR_N; Thiostrepton-resistance methylase, N terminus (PF04705; HMM-score: 13.4)
    PDDEXK (CL0236) PDDEXK_10; PD-(D/E)XK nuclease superfamily (PF07788; HMM-score: 13.2)
    HTH (CL0123) CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 13.1)
    YdaS_antitoxin; Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT (PF15943; HMM-score: 13)
    Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 12.2)
    MarR; MarR family (PF01047; HMM-score: 12.1)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.152
    • Ymax_pos: 11
    • Cmax: 0.124
    • Cmax_pos: 23
    • Smax: 0.278
    • Smax_pos: 1
    • Smean: 0.229
    • D: 0.182
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNKERNIIIAKNIRKFLNDSNMSQKKLAELINIKPSTLSDYLNLRSNPSHGVIQRIADVFEVGKSDIDTTYKDDNDITSIYNKLTPPRQENVLNYANEQLEEQNSKGDNVVDINSYKQEKTPVNVNGCVSAGVGERLHDETLFTEMVKGPIPTHDLALKVNGDSMEPMFKDGEIIFVEKTHNIKNGQIGIFIIEEEAYVKKVFVEDDRLTLVSLNKDYDDLHFYRNESVRLIGKVIL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]