From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1944 [new locus tag: NWMN_RS11215 ]
  • pan locus tag?: SAUPAN005276000
  • symbol: agrD
  • pan gene symbol?: agrD
  • synonym:
  • product: accessory gene regulator protein D

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1944 [new locus tag: NWMN_RS11215 ]
  • symbol: agrD
  • product: accessory gene regulator protein D
  • replicon: chromosome
  • strand: +
  • coordinates: 2152087..2152227
  • length: 141
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGAATACATTATTTAACTTATTTTTTGATTTTATTACTGGGATTTTAAAAAACATTGGT
    AACATCGCAGCTTATAGTACTTGTGACTTCATAATGGATGAAGTTGAAGTACCAAAAGAA
    TTAACACAATTACACGAATAA
    60
    120
    141

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1944 [new locus tag: NWMN_RS11215 ]
  • symbol: AgrD
  • description: accessory gene regulator protein D
  • length: 46
  • theoretical pI: 3.96381
  • theoretical MW: 5297.07
  • GRAVY: 0.293478

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    cyclic lactone autoinducer peptide (TIGR04223; HMM-score: 33.2)
  • TheSEED:  
    Accessory gene regulator D (pheromone precursor, type III) 
  • PFAM:
    no clan definedAgrD; Staphylococcal AgrD protein (PF05931; HMM-score: 95.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.152
    • Ymax_pos: 25
    • Cmax: 0.155
    • Cmax_pos: 25
    • Smax: 0.194
    • Smax_pos: 7
    • Smean: 0.152
    • D: 0.152
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNTLFNLFFDFITGILKNIGNIAAYSTCDFIMDEVEVPKELTQLHE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolism

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]