From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1974 [new locus tag: NWMN_RS11420 ]
  • pan locus tag?: SAUPAN005339000
  • symbol: NWMN_1974
  • pan gene symbol?: mazF
  • synonym:
  • product: PemK family DNA-binding protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1974 [new locus tag: NWMN_RS11420 ]
  • symbol: NWMN_1974
  • product: PemK family DNA-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2192598..2192960
  • length: 363
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGATTAGACGAGGAGATGTTTATTTAGCAGATTTATCACCAGTACAGGGATCTGAACAA
    GGGGGAGTCAGACCTGTAGTCATAATTCAAAATGATACTGGTAATAAATATAGTCCTACA
    GTTATTGTTGCGGCAATAACTGGTAGGATTAATAAAGCGAAAATACCGACACATGTAGAG
    ATTGAAAAGAAAAAGTATAAGTTGGATAAAGACTCAGTTATATTATTAGAACAAATTCGT
    ACACTTGATAAAAAACGATTGAAAGAAAAACTGACGTACTTATCCGATGATAAAATGAAA
    GAAGTAGATAATGCACTAATGATTAGTTTAGGGCTGAATGCAGTAGCTCACCAGAAAAAT
    TAG
    60
    120
    180
    240
    300
    360
    363

Protein[edit source | edit]

Protein Data Bank: 2MF2
Protein Data Bank: 4MZM
Protein Data Bank: 4MZP
Protein Data Bank: 4MZT
Protein Data Bank: 5DLO

General[edit source | edit]

  • locus tag: NWMN_1974 [new locus tag: NWMN_RS11420 ]
  • symbol: NWMN_1974
  • description: PemK family DNA-binding protein
  • length: 120
  • theoretical pI: 10.1686
  • theoretical MW: 13441.6
  • GRAVY: -0.389167

Function[edit source | edit]

  • reaction:
    EC 3.1.-.-?  ExPASy
  • TIGRFAM:
    Unknown functionEnzymes of unknown specificityB12-binding domain/radical SAM domain protein, MJ_1487 family (TIGR04013; HMM-score: 11.1)
  • TheSEED:  
    Regulation and Cell signalingProgrammed Cell Death and Toxin-antitoxin SystemsMazEF toxin-antitoxing (programmed cell death) system Programmed cell death toxin YdcE 
    Programmed Cell Death and Toxin-antitoxin SystemsPhd-Doc, YdcE-YdcD toxin-antitoxin (programmed cell death) systems Programmed cell death toxin YdcE 
  • PFAM:
    CcdB_PemK (CL0624) PemK_toxin; PemK-like, MazF-like toxin of type II toxin-antitoxin system (PF02452; HMM-score: 115.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.119
    • Ymax_pos: 32
    • Cmax: 0.135
    • Cmax_pos: 46
    • Smax: 0.195
    • Smax_pos: 53
    • Smean: 0.111
    • D: 0.115
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]