From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1991 [new locus tag: NWMN_RS11515 ]
  • pan locus tag?: SAUPAN005363000
  • symbol: NWMN_1991
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1991 [new locus tag: NWMN_RS11515 ]
  • symbol: NWMN_1991
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2212576..2212914
  • length: 339
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGGGATATAGTATAGTAAGGAATGTAAATGAAGGAGTGAATGCTATGACTGAACAAGAT
    AATGCACATCATTCTGAACAAATAAAAACGAATCTTAAATCACGTTTAAATCGAATTGAA
    GGACAAGTGAGAGCGATTAATCGCATGATTGAAGAAGATGTCTATTGTGATGATGTCCTT
    ACGCAAATAAGAGCGACACGTTCGGCGTTAAACAGTGTTGCGATAAAGTTATTAGAACAA
    CATATGAAAAGTTGTATTATGAATAAAGTTAATCAAGGTGCTCAGGAAGAGGCAATGGAA
    GAGTTATTAGTGACTTTTCAAAAATTGATTAAAGACTAA
    60
    120
    180
    240
    300
    339

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1991 [new locus tag: NWMN_RS11515 ]
  • symbol: NWMN_1991
  • description: hypothetical protein
  • length: 112
  • theoretical pI: 6.25313
  • theoretical MW: 12802.6
  • GRAVY: -0.480357

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingMobile and extrachromosomal element functionsProphage functionsphage terminase, large subunit, PBSX family (TIGR01547; HMM-score: 15)
    Unknown functionGeneralzinc finger protein ZPR1 homolog (TIGR00340; HMM-score: 13.9)
    two transmembrane protein (TIGR04527; HMM-score: 12)
  • TheSEED:  
    Repressor CsoR of the copZA operon 
  • PFAM:
    no clan definedTrns_repr_metal; Metal-sensitive transcriptional repressor (PF02583; HMM-score: 96.3)
    Herpes_UL14; Herpesvirus UL14-like protein (PF03580; HMM-score: 15.6)
    RPM2; Mitochondrial ribonuclease P subunit (RPM2) (PF08579; HMM-score: 14.7)
    YojJ; Bacterial membrane-spanning protein N-terminus (PF10372; HMM-score: 14.4)
    AKAP95; A-kinase anchoring protein 95 (AKAP95) (PF04988; HMM-score: 13.8)
    DHR-2; Dock homology region 2 (PF06920; HMM-score: 13)
    DUF2175; Uncharacterized protein conserved in archaea (DUF2175) (PF09943; HMM-score: 11.4)
    LMBR1; LMBR1-like membrane protein (PF04791; HMM-score: 10.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.191
    • Ymax_pos: 25
    • Cmax: 0.181
    • Cmax_pos: 25
    • Smax: 0.309
    • Smax_pos: 21
    • Smean: 0.142
    • D: 0.172
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MGYSIVRNVNEGVNAMTEQDNAHHSEQIKTNLKSRLNRIEGQVRAINRMIEEDVYCDDVLTQIRATRSALNSVAIKLLEQHMKSCIMNKVNQGAQEEAMEELLVTFQKLIKD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]