From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2032 [new locus tag: NWMN_RS11735 ]
  • pan locus tag?: SAUPAN005422000
  • symbol: rpoE
  • pan gene symbol?: rpoE
  • synonym:
  • product: DNA-directed RNA polymerase subunit delta

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2032 [new locus tag: NWMN_RS11735 ]
  • symbol: rpoE
  • product: DNA-directed RNA polymerase subunit delta
  • replicon: chromosome
  • strand: -
  • coordinates: 2249664..2250194
  • length: 531
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAAAATTCAAGATTATACAAAACAAATGGTTGATGAAAAATCATTTATTGATATGGCT
    TATACATTATTGAATGATAAAGGCGAAACAATGAACTTATATGATATCATCGATGAATTT
    AGAGCGTTAGGTGATTATGAGTACGAAGAAATTGAAAATCGTGTTGTACAATTTTACACG
    GATTTAAACACAGATGGTCGTTTTTTAAATGTTGGAGAAAATTTATGGGGATTACGTGAT
    TGGTATTCGGTAGATGATATTGAAGAGAAAATCGCACCAACTATTCAAAAATTCGATATT
    CTGGATGCAGATGATGAAGAAGATCAAAACTTAAAATTATTGGGCGAAGATGAAATGGAT
    GACGACGATGATATTCCAGCTCAAACAGATGATCAAGAAGAACTAAATGATCCAGAAGAT
    GAGCAGGTTGAAGAAGAAATCAATCATTCGGATATAGTCATTGAAGAAGATGAAGATGAA
    CTAGACGAAGACGAAGAAGTGTTTGAAGACGAAGAAGACTTCAACGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    531

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2032 [new locus tag: NWMN_RS11735 ]
  • symbol: RpoE
  • description: DNA-directed RNA polymerase subunit delta
  • length: 176
  • theoretical pI: 3.36108
  • theoretical MW: 20881
  • GRAVY: -1.0483

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingTranscriptionDNA-dependent RNA polymeraseDNA-directed RNA polymerase delta subunit (TIGR04567; EC 2.7.7.6; HMM-score: 105.4)
  • TheSEED:  
    RNA MetabolismTranscriptionRNA polymerase bacterial DNA-directed RNA polymerase delta subunit (EC 2.7.7.6) 
  • PFAM:
    HTH (CL0123) HARE-HTH; HB1, ASXL, restriction endonuclease HTH domain (PF05066; HMM-score: 36.9)
    no clan definedTFIIA; Transcription factor IIA, alpha/beta subunit (PF03153; HMM-score: 6.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_1483(dnaK)molecular chaperone DnaK  [1] (data from MRSA252)
    NWMN_0961(pdhC)branched-chain alpha-keto acid dehydrogenase subunit E2  [1] (data from MRSA252)
    NWMN_0962(pdhD)dihydrolipoamide dehydrogenase  [1] (data from MRSA252)
    NWMN_0959(phdA)pyruvate dehydrogenase E1 component, alpha subunit  [1] (data from MRSA252)
    NWMN_0960(phdB)pyruvate dehydrogenase E1 component, beta subunit  [1] (data from MRSA252)
    NWMN_2149(rplB)50S ribosomal protein L2  [1] (data from MRSA252)
    NWMN_1572(rplT)50S ribosomal protein L20  [1] (data from MRSA252)
    NWMN_1549(rplU)50S ribosomal protein L21  [1] (data from MRSA252)
    NWMN_0504(rpoB)DNA-directed RNA polymerase subunit beta  [1] (data from MRSA252)
    NWMN_0505(rpoC)DNA-directed RNA polymerase subunit beta'  [1] (data from MRSA252)
    NWMN_1326(sucA)2-oxoglutarate dehydrogenase E1 component  [1] (data from MRSA252)
    NWMN_1325(sucB)dihydrolipoamide succinyltransferase  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.093
    • Ymax_pos: 46
    • Cmax: 0.101
    • Cmax_pos: 30
    • Smax: 0.107
    • Smax_pos: 38
    • Smean: 0.077
    • D: 0.086
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKIQDYTKQMVDEKSFIDMAYTLLNDKGETMNLYDIIDEFRALGDYEYEEIENRVVQFYTDLNTDGRFLNVGENLWGLRDWYSVDDIEEKIAPTIQKFDILDADDEEDQNLKLLGEDEMDDDDDIPAQTDDQEELNDPEDEQVEEEINHSDIVIEEDEDELDEDEEVFEDEEDFND

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11

Relevant publications[edit source | edit]