From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2175 [new locus tag: NWMN_RS12570 ]
  • pan locus tag?: SAUPAN005736000
  • symbol: moaB
  • pan gene symbol?: moaB
  • synonym:
  • product: molybdopterin precursor biosynthesis moaB

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2175 [new locus tag: NWMN_RS12570 ]
  • symbol: moaB
  • product: molybdopterin precursor biosynthesis moaB
  • replicon: chromosome
  • strand: -
  • coordinates: 2398419..2398925
  • length: 507
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGGCGAACATCAAAACGTTAAATTGAATCGTACAGTTAAAGCAGCCGTACTAACGGTA
    TCAGATACTAGAGACTTTGATACAGATAAAGGTGGTCAATGCGTGCGCCAACTATTACAA
    GCAGATGACGTTGAAGTGAGTGACGCACATTATACAATTGTGAAAGATGAAAAAGTAGCC
    ATCACGACGCAGGTGAAGAAGTGGTTAGAAGAAGATATTGATGTCATCATTACGACTGGT
    GGAACAGGTATTGCACAACGTGATGTGACGATTGAAGCAGTAAAACCACTTTTAACTAAA
    GAGATAGAAGGCTTTGGGGAATTGTTTAGATATTTGAGTTATGTTGAAGATGTTGGCACG
    CGTGCATTATTGTCTCGTGCTGTAGCAGGTACAGTTAATAATAAATTGATATTTTCGATT
    CCAGGATCAACAGGCGCAGTTAAATTAGCATTAGAAAAGCTCATTAAACCAGAATTAAAT
    CATCTGATTCATGAGCTTACAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    507

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2175 [new locus tag: NWMN_RS12570 ]
  • symbol: MoaB
  • description: molybdopterin precursor biosynthesis moaB
  • length: 168
  • theoretical pI: 5.68373
  • theoretical MW: 18500.1
  • GRAVY: -0.119643

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMolybdopterinmolybdenum cofactor biosynthesis protein B (TIGR02667; HMM-score: 159.3)
    molybdenum cofactor synthesis domain (TIGR00177; HMM-score: 122.1)
    Genetic information processingDNA metabolismDNA replication, recombination, and repaircompetence/damage-inducible protein CinA N-terminal domain (TIGR00200; HMM-score: 11.3)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, PigmentsFolate and pterinesMolybdenum cofactor biosynthesis Molybdenum cofactor biosynthesis protein MoaB 
  • PFAM:
    no clan definedMoCF_biosynth; Probable molybdopterin binding domain (PF00994; HMM-score: 110.7)
    AA_dh_N (CL0603) malic; Malic enzyme, N-terminal domain (PF00390; HMM-score: 12.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.162
    • Ymax_pos: 11
    • Cmax: 0.117
    • Cmax_pos: 27
    • Smax: 0.484
    • Smax_pos: 4
    • Smean: 0.285
    • D: 0.21
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MGEHQNVKLNRTVKAAVLTVSDTRDFDTDKGGQCVRQLLQADDVEVSDAHYTIVKDEKVAITTQVKKWLEEDIDVIITTGGTGIAQRDVTIEAVKPLLTKEIEGFGELFRYLSYVEDVGTRALLSRAVAGTVNNKLIFSIPGSTGAVKLALEKLIKPELNHLIHELTK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]