From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2341 [new locus tag: NWMN_RS13485 ]
  • pan locus tag?: SAUPAN005993000
  • symbol: NWMN_2341
  • pan gene symbol?:
  • synonym:
  • product: NAD dependent epimerase/dehydratase family protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2341 [new locus tag: NWMN_RS13485 ]
  • symbol: NWMN_2341
  • product: NAD dependent epimerase/dehydratase family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2574525..2575376
  • length: 852
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAGTAAAATTTTTGTAACTGGTGCAACGGGCCTTATTGGCATTAAATTAGTTCAAAGA
    CTAAAAGAAGAGGGGCATGAGGTTGCTGGTTTTACTACATCTGAGAATGGTCAACAAAAG
    CTAGCTGCTGTTAATGTAAAAGCATATATTGGTGATATATTAAAAGCTGATACTATTGAT
    CAAGCGTTAGCAGATTTTAAACCAGAAATCATTATCAATCAAATTACGGATTTAAAAAAT
    GTTGATATGGCAGCAAATACGAAAGTACGTATTGAAGGTTCTAAAAACCTAATTGATGCG
    GCGAAAAAGCATGACGTTAAGAAAGTAATTGCCCAAAGTATTGCCTTTATGTATGAACCT
    GGCGAAGGATTAGCAAATGAGGAAACTTCACTTGATTTTAACTCAACTGGCGATAGAAAA
    GTAACGGTTGATGGTGTGGTTGGTTTAGAAGAAGAAACGGCTCGTATGGATGAATACGTT
    GTTTTACGTTTTGGCTGGTTATATGGCCCAGGTACTTGGTACGGAAAAGATGGCATGATT
    TATAATCAATTTATGGATGGTCAAGTGACACTTTCAGATGGCGTAACATCATTTGTGCAT
    CTTGATGATGCAGTTGAAACATCTATTCAAGCTATTCATTTTGAAAATGGTATCTATAAT
    GTAGCAGATGATGCACCTGTTAAAGGTTCTGAATTTGCAGAATGGTATAAAGAACAACTT
    GGTGTTGAACCAAATATTGATATTCAACCTGCGCAACCATTTGAACGTGGCGTAAGCAAT
    GAGAAGTTTAAAGCGCAAGGTGGTACTCTGATTTATCAAACTTGGAAAGATGGCATGAAT
    CCAATTAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    852

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2341 [new locus tag: NWMN_RS13485 ]
  • symbol: NWMN_2341
  • description: NAD dependent epimerase/dehydratase family protein
  • length: 283
  • theoretical pI: 4.47599
  • theoretical MW: 31192
  • GRAVY: -0.30106

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    hopanoid-associated sugar epimerase (TIGR03466; HMM-score: 55.1)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesADP-glyceromanno-heptose 6-epimerase (TIGR02197; EC 5.1.3.20; HMM-score: 46.7)
    Hypothetical proteinsConservedTIGR01777 family protein (TIGR01777; HMM-score: 45.3)
    MetabolismEnergy metabolismSugarsUDP-glucose 4-epimerase GalE (TIGR01179; EC 5.1.3.2; HMM-score: 35.7)
    NAD dependent epimerase/dehydratase, LLPSF_EDH_00030 family (TIGR04180; HMM-score: 32.9)
    UDP-N-acetylglucosamine 4,6-dehydratase (inverting) (TIGR03589; EC 4.2.1.115; HMM-score: 32.5)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesdTDP-4-dehydrorhamnose reductase (TIGR01214; EC 1.1.1.133; HMM-score: 31.9)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesCDP-glucose 4,6-dehydratase (TIGR02622; EC 4.2.1.45; HMM-score: 29.1)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharidesbeta-phosphoglucomutase (TIGR01990; EC 5.4.2.6; HMM-score: 18.6)
    thioester reductase domain (TIGR01746; HMM-score: 18.5)
    lipid biosynthesis B12-binding/radical SAM protein (TIGR04072; HMM-score: 18.2)
    ergot alkaloid biosynthesis protein, AFUA_2G17970 family (TIGR03649; HMM-score: 17.8)
    acetoacetyl-CoA reductase (TIGR01829; EC 1.1.1.36; HMM-score: 17)
    Unknown functionEnzymes of unknown specificityputative quinone oxidoreductase, YhdH/YhfP family (TIGR02823; HMM-score: 15.3)
    2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (TIGR04316; EC 1.3.1.28; HMM-score: 14.8)
    MetabolismFatty acid and phospholipid metabolismBiosynthesis3-oxoacyl-[acyl-carrier-protein] reductase (TIGR01830; EC 1.1.1.100; HMM-score: 13.7)
    2-hydroxycyclohexanecarboxyl-CoA dehydrogenase (TIGR03206; EC 1.1.1.-; HMM-score: 13.6)
    3-hydroxybutyrate dehydrogenase (TIGR01963; HMM-score: 13.4)
  • TheSEED:  
    Hypothetical protein, similar to glucose epimerase 
  • PFAM:
    NADP_Rossmann (CL0063) Epimerase; NAD dependent epimerase/dehydratase family (PF01370; HMM-score: 70.6)
    NAD_binding_10; NAD(P)H-binding (PF13460; HMM-score: 50.6)
    3Beta_HSD; 3-beta hydroxysteroid dehydrogenase/isomerase family (PF01073; HMM-score: 48.3)
    RmlD_sub_bind; RmlD substrate binding domain (PF04321; HMM-score: 40.4)
    Polysacc_synt_2; Polysaccharide biosynthesis protein (PF02719; HMM-score: 34.4)
    NmrA; NmrA-like family (PF05368; HMM-score: 26.6)
    GDP_Man_Dehyd; GDP-mannose 4,6 dehydratase (PF16363; HMM-score: 26.4)
    NAD_binding_2; NAD binding domain of 6-phosphogluconate dehydrogenase (PF03446; HMM-score: 17.3)
    Semialdhyde_dh; Semialdehyde dehydrogenase, NAD binding domain (PF01118; HMM-score: 17)
    adh_short; short chain dehydrogenase (PF00106; HMM-score: 16.5)
    TrkA_N; TrkA-N domain (PF02254; HMM-score: 16.3)
    DapB_N; Dihydrodipicolinate reductase, N-terminus (PF01113; HMM-score: 13.2)
    KR; KR domain (PF08659; HMM-score: 12.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 0.83
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.19
    • Ymax_pos: 26
    • Cmax: 0.13
    • Cmax_pos: 43
    • Smax: 0.436
    • Smax_pos: 21
    • Smean: 0.248
    • D: 0.212
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSKIFVTGATGLIGIKLVQRLKEEGHEVAGFTTSENGQQKLAAVNVKAYIGDILKADTIDQALADFKPEIIINQITDLKNVDMAANTKVRIEGSKNLIDAAKKHDVKKVIAQSIAFMYEPGEGLANEETSLDFNSTGDRKVTVDGVVGLEEETARMDEYVVLRFGWLYGPGTWYGKDGMIYNQFMDGQVTLSDGVTSFVHLDDAVETSIQAIHFENGIYNVADDAPVKGSEFAEWYKEQLGVEPNIDIQPAQPFERGVSNEKFKAQGGTLIYQTWKDGMNPIK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]