From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2369
  • pan locus tag?: SAUPAN006035000
  • symbol: NWMN_2369
  • pan gene symbol?:
  • synonym:
  • product: short chain dehydrogenase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2369
  • symbol: NWMN_2369
  • product: short chain dehydrogenase
  • replicon: chromosome
  • strand: -
  • coordinates: 2606868..2607506
  • length: 639
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    GTGGATAATGCAAGCGAACAACAAGTGGTAGACTTTGTGTCTGACATAAAGGAACAGTTT
    GGAAGAATCGATGTGTTGTTTAATAATGCCGGTGTGGATAATGCGGCTGATAGAATTCAT
    GAGTATCCAATAGATGTGTATGACAAGATTATGAATGTAGATATGCGTGGGACATTTTTA
    ATGACGAAAATGATGTTACCTTTAATGATGAATCAAGGTGGCTCTATTGTTAATACGTCT
    TCATTTTCCGGACAAGCAGCAGACTTGTATCGCTCTGGATATAATGCTGCGAAAGGTGCA
    GTGATTAATTTTACAAAATCAATCGCAATTGAGTATGGCCGTGATAGCATTCGAGCCAAT
    GCGATTGCACCAGGTACAATTGAAACCCCGTTAGTAGATAAACTGACAGGTACGAGTGAG
    GATGATGCAGGTAAAACATTTAGAGAAAATCAAAAATGGATGACTCCGCTGGGACGTTTA
    GGTAAACCAGAAGAAGTTGCTAAATTAGTAGTCTTCTTAGCATCTGACGACAGTTCATTC
    ATAACTGGAGAGACGATTCGAATTGATGGTGGTGTGATGGCTTACACATGGCCTGGCGAG
    ATGTTAAGTGATGATTCGTGGAAGCGGACATTGGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    639

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2369
  • symbol: NWMN_2369
  • description: short chain dehydrogenase
  • length: 212
  • theoretical pI: 4.37938
  • theoretical MW: 23385.3
  • GRAVY: -0.270755

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismFatty acid and phospholipid metabolismBiosynthesis3-oxoacyl-[acyl-carrier-protein] reductase (TIGR01830; EC 1.1.1.100; HMM-score: 153.3)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR03971; EC 1.1.99.-; HMM-score: 142.1)
    3-hydroxybutyrate dehydrogenase (TIGR01963; HMM-score: 141.9)
    acetoacetyl-CoA reductase (TIGR01829; EC 1.1.1.36; HMM-score: 129.8)
    MetabolismEnergy metabolismFermentationacetoin reductases (TIGR02415; EC 1.1.1.-; HMM-score: 117)
    2-hydroxycyclohexanecarboxyl-CoA dehydrogenase (TIGR03206; EC 1.1.1.-; HMM-score: 116.9)
    2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (TIGR04316; EC 1.3.1.28; HMM-score: 114.2)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharides2-deoxy-D-gluconate 3-dehydrogenase (TIGR01832; EC 1.1.1.125; HMM-score: 112.3)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR04504; EC 1.1.99.-; HMM-score: 92.3)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisputative 3-oxoacyl-(acyl-carrier-protein) reductase (TIGR01831; HMM-score: 81.9)
    rhamnulose-1-phosphate aldolase/alcohol dehydrogenase (TIGR02632; EC 1.1.1.1,4.1.2.19; HMM-score: 70.3)
    cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (TIGR03325; EC 1.3.1.56; HMM-score: 66.2)
    pteridine reductase (TIGR02685; EC 1.5.1.33; HMM-score: 53.1)
    sepiapterin reductase (TIGR01500; EC 1.1.1.153; HMM-score: 19)
  • TheSEED:  
    Fatty Acids, Lipids, and IsoprenoidsFatty acidsFatty Acid Biosynthesis FASII 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) 
  • PFAM:
    NADP_Rossmann (CL0063) adh_short_C2; Enoyl-(Acyl carrier protein) reductase (PF13561; HMM-score: 190.9)
    adh_short; short chain dehydrogenase (PF00106; HMM-score: 122.9)
    KR; KR domain (PF08659; HMM-score: 12.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.115
    • Ymax_pos: 36
    • Cmax: 0.161
    • Cmax_pos: 36
    • Smax: 0.134
    • Smax_pos: 35
    • Smean: 0.066
    • D: 0.096
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MDNASEQQVVDFVSDIKEQFGRIDVLFNNAGVDNAADRIHEYPIDVYDKIMNVDMRGTFLMTKMMLPLMMNQGGSIVNTSSFSGQAADLYRSGYNAAKGAVINFTKSIAIEYGRDSIRANAIAPGTIETPLVDKLTGTSEDDAGKTFRENQKWMTPLGRLGKPEEVAKLVVFLASDDSSFITGETIRIDGGVMAYTWPGEMLSDDSWKRTLE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: SigB [1] other strains
    SigB (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J. Bacteriol.: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

Relevant publications[edit source | edit]