From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2389 [new locus tag: NWMN_RS13755 ]
  • pan locus tag?: SAUPAN006092000
  • symbol: NWMN_2389
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2389 [new locus tag: NWMN_RS13755 ]
  • symbol: NWMN_2389
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2625223..2625489
  • length: 267
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGAAAGGCTCTAAACAAATACTTTTGATTATGGGCATTATATCTCTTATTGTTTTATTT
    ATTTTTACACTATTCATCATGGCGCAATATGCAAAACATTATGAACAAAAATCCGACAGT
    TCCAACGCACATACTTTAAATTCATCATCAGCCATAATTGAGCAACATACTATGTCGAAT
    TTAGCGTCTCTAGATTTATACGCTCCTGTTCGTAACATTACTTCTAGTCGTGATATTCAT
    CCCATTTATTTCATGACAAAAGATTAA
    60
    120
    180
    240
    267

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2389 [new locus tag: NWMN_RS13755 ]
  • symbol: NWMN_2389
  • description: hypothetical protein
  • length: 88
  • theoretical pI: 8.94062
  • theoretical MW: 9964.55
  • GRAVY: 0.176136

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01107928: hypothetical protein 
  • PFAM:
    Tetraspannin (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 17.2)
    no clan definedSelK_SelG; Selenoprotein SelK_SelG (PF10961; HMM-score: 15.8)
    Sigma_reg_N; Sigma factor regulator N-terminal (PF13800; HMM-score: 13.5)
    EphA2_TM; Ephrin type-A receptor 2 transmembrane domain (PF14575; HMM-score: 13.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: 7
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.449
    • Ymax_pos: 34
    • Cmax: 0.475
    • Cmax_pos: 34
    • Smax: 0.665
    • Smax_pos: 28
    • Smean: 0.337
    • D: 0.405
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKGSKQILLIMGIISLIVLFIFTLFIMAQYAKHYEQKSDSSNAHTLNSSSAIIEQHTMSNLASLDLYAPVRNITSSRDIHPIYFMTKD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]