From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2419 [new locus tag: NWMN_RS13910 ]
  • pan locus tag?: SAUPAN006165000
  • symbol: NWMN_2419
  • pan gene symbol?:
  • synonym:
  • product: acetyltransferase, GNAT family protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2419 [new locus tag: NWMN_RS13910 ]
  • symbol: NWMN_2419
  • product: acetyltransferase, GNAT family protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2663130..2663423
  • length: 294
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    TTGATATGTATGAGTAACCTTGAAATCAAACAAGGCGAGAACAAATTCTATATTGGTGAT
    GATGAAAATAATGCTTTAGCTGAAATCACATACCGTTTTGTGGATAATAATGAAATTAAC
    ATTGATCATACAGGCGTATCTGATGAACTTGGTGGTCAAGGTGTTGGCAAAAAACTACTT
    AAAGCAGTTGTTGAACACGCTCGAGAAAATAATTTGAAAATTATTGCCTCATGTTCATTT
    GCCAAACATATGTTAGAAAAAGAAGATTCATATCAAGATGTATATCTTGGTTAA
    60
    120
    180
    240
    294

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2419 [new locus tag: NWMN_RS13910 ]
  • symbol: NWMN_2419
  • description: acetyltransferase, GNAT family protein
  • length: 97
  • theoretical pI: 4.54531
  • theoretical MW: 10895.2
  • GRAVY: -0.449485

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 23.2)
    methanogenesis imperfect marker protein 11 (TIGR03280; HMM-score: 12.3)
  • TheSEED:  
    Acetyltransferase (GNAT) family protein 
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_CG; GCN5-related N-acetyl-transferase (PF14542; HMM-score: 89)
    Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 28.5)
    Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 27.8)
    Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 17.2)
    NTP_transf (CL0260) Pox_polyA_pol; Poxvirus poly(A) polymerase nucleotidyltransferase domain (PF03296; HMM-score: 13)
    no clan definedDUF2312; Uncharacterized protein conserved in bacteria (DUF2312) (PF10073; HMM-score: 12.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.109
    • Ymax_pos: 68
    • Cmax: 0.118
    • Cmax_pos: 68
    • Smax: 0.134
    • Smax_pos: 17
    • Smean: 0.093
    • D: 0.102
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MICMSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLLKAVVEHARENNLKIIASCSFAKHMLEKEDSYQDVYLG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]