From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2558 [new locus tag: NWMN_RS14685 ]
  • pan locus tag?: SAUPAN006404000
  • symbol: NWMN_2558
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2558 [new locus tag: NWMN_RS14685 ]
  • symbol: NWMN_2558
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2827155..2827766
  • length: 612
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGTATACGTTTGATGCACAATCATTAACTGCTAGAGAAAACTATAAATTATTAATTGGT
    TCAATTATTCCACGACCTATAGCTTTTGTTACAACATTAAATCAAGATGCATCAGTAAAT
    GCAGCACCATTTAGCTTTTTTAATATTGTTAATAATCATCCGCCAATGATTGCTATTGCA
    GTTCAACGTGCAGGAGGTAAGAGAAAAGATACTGCATTAAATATAGAACGGACTGGAGAC
    TTTGTTGTGCATATTACAGACGAAGATAATGTTCAAGATATTAATGAGACTGCAGCGCCG
    TTAGCATATGGTGACAGTGAGTTGAGTCGTACAGAATTATCACTTTTAACATCTACAACG
    ATTAAGACGCCAGGAATTAAAGATGCGAAAATGAGATTCGAATGTAAACTATCGCAAATG
    ATATTGCTTGGAGATGTATTAGATGGGGCTGATTTAATAATAGGTGAAATTGTAACTTAT
    CATATTGATGACAGTATTTATGAGGGTGATTTTAAAATCAATCCACACGCATTACAGGCT
    GTTTCTCGTTTAGCCGGAAATGATTATGCTAAATTAGGGGGAATATTTACGATAAAGAGA
    CCAGAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    612

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2558 [new locus tag: NWMN_RS14685 ]
  • symbol: NWMN_2558
  • description: hypothetical protein
  • length: 203
  • theoretical pI: 5.04227
  • theoretical MW: 22315.3
  • GRAVY: -0.0935961

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01108172: hypothetical protein 
  • PFAM:
    FMN-binding (CL0336) Flavin_Reduct; Flavin reductase like domain (PF01613; HMM-score: 70.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.228
    • Ymax_pos: 42
    • Cmax: 0.147
    • Cmax_pos: 42
    • Smax: 0.524
    • Smax_pos: 27
    • Smean: 0.268
    • D: 0.243
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MYTFDAQSLTARENYKLLIGSIIPRPIAFVTTLNQDASVNAAPFSFFNIVNNHPPMIAIAVQRAGGKRKDTALNIERTGDFVVHITDEDNVQDINETAAPLAYGDSELSRTELSLLTSTTIKTPGIKDAKMRFECKLSQMILLGDVLDGADLIIGEIVTYHIDDSIYEGDFKINPHALQAVSRLAGNDYAKLGGIFTIKRPEK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: SigB [1] other strains
    SigB (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]