From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2567 [new locus tag: NWMN_RS14730 ]
  • pan locus tag?: SAUPAN006413000
  • symbol: icaB
  • pan gene symbol?: icaB
  • synonym:
  • product: intercellular adhesion protein B

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2567 [new locus tag: NWMN_RS14730 ]
  • symbol: icaB
  • product: intercellular adhesion protein B
  • replicon: chromosome
  • strand: +
  • coordinates: 2834271..2835143
  • length: 873
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    GTGAAGTATAGAAAATTTATAATTTTAGTGTTGAGTATCTTGATCATATTGCCTGTAAGC
    ACACTGGATGGTCATCATATTGCAAATGCAGATGACGATTCACCTAAAAAACTGAAATAT
    AAAGAAAATAGTGCTCTGGCATTAAATTATCACCGTGTAAGAAAAGCGAATTTTCTGAAT
    AATTTTATTTACTTCTTTTCTAGTAGTAAAGAAATTAAAAATTATAGTGTTAGTCAATCA
    CAATTTGAATCTCAAATAAAATGGCTAAAATCACATGATGCTAAATTTTTAACCTTGAAA
    GAATTTTTATATTACAAGAAAAAAGGTAAGTTTCCAAAACGAAGTGTATGGATTAACTTT
    GATGATATGGATGAAACTATTTATGAAAATGCTTATCCAATCTTAAAAAAATATAAAATA
    CCGGCAACTGGGTTTATTATCACAGGTCATGTTGGGGAAGAAAACTTTCACAACCTCGAT
    ATGATTAGTAAAAAAGAACTAAAAGAAATGTATAAAACTGGGTTATGGGAATTTGAAACA
    CATACCCACGATTTGCATAACTTATCTAAAAATAATAAGTCAAAATTAATGAAAGCTTCT
    GAAGCTACAATCATAAAAGATTTAAACAAAAGTGAAAAATATCTAACTAAAAACTTTAAA
    AAGTCGCAGAAAACTATAGCCTATCCTTATGGCTTGATGAATGACGATAAATTACCGGTA
    ATCAAAAAAGCTGGGTTAAAATACGGTTTTTCATTAGAGGAAAAAGCAGTCACTCCGAAC
    TCCAATGATTATTACATCCCTAGAATATTAATTAGTGATGATGCTTTTGAGCATTTAATT
    AAGAGATGGGACGGATTCCATGAAAAAGATTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    873

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2567 [new locus tag: NWMN_RS14730 ]
  • symbol: IcaB
  • description: intercellular adhesion protein B
  • length: 290
  • theoretical pI: 9.93319
  • theoretical MW: 34105.1
  • GRAVY: -0.601034

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesintercellular adhesin biosynthesis polysaccharide N-deacetylase (TIGR03933; EC 3.5.1.-; HMM-score: 456.7)
    Cellular processesCellular processesPathogenesisintercellular adhesin biosynthesis polysaccharide N-deacetylase (TIGR03933; EC 3.5.1.-; HMM-score: 456.7)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidespoly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB (TIGR03938; EC 3.5.1.-; HMM-score: 110.6)
    Cellular processesCellular processesSporulation and germinationpolysaccharide deacetylase family sporulation protein PdaB (TIGR02764; HMM-score: 26.4)
    chitooligosaccharide deacetylase NodB (TIGR04243; EC 3.5.1.-; HMM-score: 17.1)
  • TheSEED:  
    Regulation and Cell signalingQuorum sensing and biofilm formationBiofilm formation in Staphylococcus Polysaccharide intercellular adhesin (PIA) biosynthesis deacetylase IcaB (EC 3.-.-.-) 
  • PFAM:
    GH_CE (CL0158) Polysacc_deac_1; Polysaccharide deacetylase (PF01522; HMM-score: 105.1)
    no clan definedPRESAN; Plasmodium RESA N-terminal (PF09687; HMM-score: 17.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.02
    • Extracellular Score: 9.98
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: 7
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide length 31 aa
    • Ymax: 0.547
    • Ymax_pos: 31
    • Cmax: 0.416
    • Cmax_pos: 31
    • Smax: 0.912
    • Smax_pos: 21
    • Smean: 0.734
    • D: 0.62
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKYRKFIILVLSILIILPVSTLDGHHIANADDDSPKKLKYKENSALALNYHRVRKANFLNNFIYFFSSSKEIKNYSVSQSQFESQIKWLKSHDAKFLTLKEFLYYKKKGKFPKRSVWINFDDMDETIYENAYPILKKYKIPATGFIITGHVGEENFHNLDMISKKELKEMYKTGLWEFETHTHDLHNLSKNNKSKLMKASEATIIKDLNKSEKYLTKNFKKSQKTIAYPYGLMNDDKLPVIKKAGLKYGFSLEEKAVTPNSNDYYIPRILISDDAFEHLIKRWDGFHEKD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulators: CodY, IcaR
    CodY (TF) important in Amino acid metabolism  RegPrecise    transcription unit transferred from N315 data RegPrecise
    IcaR (TF) important in Intercellular adhesion  RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]