From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2578 [new locus tag: NWMN_RS14790 ]
  • pan locus tag?: SAUPAN006435000
  • symbol: hisZ
  • pan gene symbol?: hisZ
  • synonym:
  • product: ATP phosphoribosyltransferase regulatory subunit

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2578 [new locus tag: NWMN_RS14790 ]
  • symbol: hisZ
  • product: ATP phosphoribosyltransferase regulatory subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 2845815..2846633
  • length: 819
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    GTGAATAATTCAGAACAATTAATTGCGTTAAAAGAATCGGAAACAGCATTTTTAAAATAT
    TTTAATAAAGCGGATTATGAGTTAGTTGATTTTAGTGTGGTTGAAAAGTTGGACTGGAAA
    CAATTGAACCATGAGGATTTGCAGCAGATGGGTGAGCGAAATTTTTGGCAACATGAGCAT
    CAAATTTATGCACTTCGAAATGATTTTACAGATCAATTATTGCGTTATTACTCAATGTAT
    CCAACTGCAGCAACAAAAGTGGCATACACAGGTTTAATCATTCGGAATAATGAAGCGGCT
    GTACAAGTTGGTTTGGAAAACTATGCACCATCATTAGCGAATGTGCAACAGAGCTTAAAG
    CTCTTTATTCAGTTTATTCAACAGCAGTTGAGAGACAACGTGCATTTTGTTGTATTGGGA
    CATTATCAATTGCTTGATGCCTTACTCGATAAATCGTTACAAACACCAGACATACTATCA
    ATGATTGAGGAACGTAATTTATCGGGACTGGTTACATATTTGTCGACTGAACATCCAATC
    GTGCAAATCTTGAAAGAGAATACGCAACAACAATTAAATGTATTGGAACACTATATTCCA
    AATGACCATCCAGCACTCGTTGAATTAAAAATATGGGAACGTTGGTTACATAAACAAGGT
    TACAAAGACATCCATTTAGATATTACTGCGCAGCCACCTAGATCCTATTACACAGGTTTA
    TTTATTCAATGTCATTTTGCTGAAAATGAATCTCGAGTTTTAACAGGTGGTTATTACAAA
    GGAAGCATCGAAGGGTTTGGATTAGGATTAACACTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    819

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2578 [new locus tag: NWMN_RS14790 ]
  • symbol: HisZ
  • description: ATP phosphoribosyltransferase regulatory subunit
  • length: 272
  • theoretical pI: 5.52082
  • theoretical MW: 31680.7
  • GRAVY: -0.341912

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismAmino acid biosynthesisHistidine familyATP phosphoribosyltransferase, regulatory subunit (TIGR00443; HMM-score: 52.3)
  • TheSEED:  
    Amino Acids and DerivativesHistidine MetabolismHistidine Biosynthesis ATP phosphoribosyltransferase regulatory subunit (EC 2.4.2.17) 
  • PFAM:
    tRNA_synt_II (CL0040) tRNA-synt_His; Histidyl-tRNA synthetase (PF13393; HMM-score: 67.8)
    F-box (CL0271) Elongin_A; RNA polymerase II transcription factor SIII (Elongin) subunit A (PF06881; HMM-score: 16.8)
    no clan definedTape_meas_lam_C; Lambda phage tail tape-measure protein (Tape_meas_lam_C) (PF09718; HMM-score: 13.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.117
    • Ymax_pos: 11
    • Cmax: 0.11
    • Cmax_pos: 25
    • Smax: 0.191
    • Smax_pos: 2
    • Smean: 0.13
    • D: 0.122
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNNSEQLIALKESETAFLKYFNKADYELVDFSVVEKLDWKQLNHEDLQQMGERNFWQHEHQIYALRNDFTDQLLRYYSMYPTAATKVAYTGLIIRNNEAAVQVGLENYAPSLANVQQSLKLFIQFIQQQLRDNVHFVVLGHYQLLDALLDKSLQTPDILSMIEERNLSGLVTYLSTEHPIVQILKENTQQQLNVLEHYIPNDHPALVELKIWERWLHKQGYKDIHLDITAQPPRSYYTGLFIQCHFAENESRVLTGGYYKGSIEGFGLGLTL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulators: NWMN_1845 (HisR*), CodY
    HisR* (TF) important in Histidine biosynthesis  RegPrecise
    CodY (TF) important in Amino acid metabolism  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]