From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS00250 [old locus tag: NWMN_0042 ]
  • pan locus tag?: SAUPAN000860000
  • symbol: NWMN_RS00250
  • pan gene symbol?: csa1A
  • synonym:
  • product: tandem-type lipoprotein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS00250 [old locus tag: NWMN_0042 ]
  • symbol: NWMN_RS00250
  • product: tandem-type lipoprotein
  • replicon: chromosome
  • strand: +
  • coordinates: 55461..56231
  • length: 771
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (55461..56231) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGATGAAACGATTAAACAAATTAGTGTTAGGCATTATTTTTCTGTTTTTAGTCATTAGT
    ATCACTGCTGGTTGTGGCATAGGTAAAGAAGCGGAAGTTAAGAAAAGCTTTGAAAAAACA
    TTGAGTATGTACCCTATTAAAAATCTAGAGGATTTATACGATAAGGAAGGCTATCGTGAT
    GATCAGTTTGATAAAAATGATAAAGGTACATGGATTATAAATTCTGAAATGGTTATTCAA
    CCTAATAATGAAGATATGGTAGCTAAAGGCATGGTTCTATATATGAATAGAAATACCAAA
    ACAACAAATGGTTACTACTATGTCGATGTGACTAAGGACGAGGATGAAGGAAAACCGCAC
    GACAATGAAAAAAGATATCCGGTTAAAATGGTCGATAATAAAATCATTCCAACAAAAGAA
    ATTAAAGATGAAAAAATAAAAAAAGAAATCGAAAACTTTAAGTTCTTTGTTCAATATGGC
    GACTTTAAAAATTTGAAAAATTATAAAGACGGAGATATTTCATATAATCCAGAGGTGCCG
    AGTTATTCGGCTAAATATCAATTAACTAATGATGATTATAATGTAAAACAATTACGCAAA
    AGATATGATATACCGACGAGTAAAGCTCCAAAGTTATTGTTAAAAGGTTCAGGGAATTTA
    AAAGGCTCATCAGTTGGATATAAAGATATTGAATTTACGTTTGTAGAGAAAAAAGAAGAA
    AATATATACTTTAGTGATAGCTTAGATTATAAAAAAAGCGGAGATGTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    771

Protein[edit source | edit]

Protein Data Bank: 4BIH

General[edit source | edit]

  • locus tag: NWMN_RS00250 [old locus tag: NWMN_0042 ]
  • symbol: NWMN_RS00250
  • description: tandem-type lipoprotein
  • length: 256
  • theoretical pI: 8.65284
  • theoretical MW: 29786.8
  • GRAVY: -0.793359

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Staphylococcus tandem lipoproteins (TIGR01742; HMM-score: 381.5)
  • TheSEED:
  • PFAM:
    LolA_LolB (CL0048) DUF576; Csa1 family (PF04507; HMM-score: 414.3)
    no clan definedDUF3519; Protein of unknown function (DUF3519) (PF12033; HMM-score: 11.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.318
    • Ymax_pos: 29
    • Cmax: 0.174
    • Cmax_pos: 29
    • Smax: 0.732
    • Smax_pos: 14
    • Smean: 0.625
    • D: 0.438
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_000977774 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MMKRLNKLVLGIIFLFLVISITAGCGIGKEAEVKKSFEKTLSMYPIKNLEDLYDKEGYRDDQFDKNDKGTWIINSEMVIQPNNEDMVAKGMVLYMNRNTKTTNGYYYVDVTKDEDEGKPHDNEKRYPVKMVDNKIIPTKEIKDEKIKKEIENFKFFVQYGDFKNLKNYKDGDISYNPEVPSYSAKYQLTNDDYNVKQLRKRYDIPTSKAPKLLLKGSGNLKGSSVGYKDIEFTFVEKKEENIYFSDSLDYKKSGDV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS00250 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]