From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS01290 [old locus tag: NWMN_0232 ]
  • pan locus tag?: SAUPAN001197000
  • symbol: NWMN_RS01290
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS01290 [old locus tag: NWMN_0232 ]
  • symbol: NWMN_RS01290
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 291679..291897
  • length: 219
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (291679..291897) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGGAAAACCAAAAACAAGGCAATGGCTTAAAAATTGCAACATGGGTATTTATTGTATTA
    ACAGTAGTTACACCGCTATTTGGTATTGGAAGTATTGTTTGTAGTATTAATTATAAAAAA
    TACGATGCTGAAAAAGGTTCGAAGTTATTGCAAATTGCAATTATCGTAACAATAATTGCT
    TTTGTTTTAAATTTATTAGCATATTTAGGTTTAAGATAA
    60
    120
    180
    219

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS01290 [old locus tag: NWMN_0232 ]
  • symbol: NWMN_RS01290
  • description: hypothetical protein
  • length: 72
  • theoretical pI: 9.97598
  • theoretical MW: 7926.51
  • GRAVY: 0.795833

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedDUF4293; Domain of unknown function (DUF4293) (PF14126; HMM-score: 18.3)
    AWPM-19; AWPM-19-like family (PF05512; HMM-score: 16.5)
    RTA1; RTA1 like protein (PF04479; HMM-score: 13.6)
    DUF4282; Domain of unknown function (DUF4282) (PF14110; HMM-score: 13)
    C_Lectin (CL0056) Chordopox_A33R; Chordopoxvirus A33R protein (PF05966; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.178
    • Ymax_pos: 36
    • Cmax: 0.173
    • Cmax_pos: 44
    • Smax: 0.291
    • Smax_pos: 30
    • Smean: 0.181
    • D: 0.179
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

  • GI: 446353452 NCBI
  • RefSeq: WP_000431307 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MENQKQGNGLKIATWVFIVLTVVTPLFGIGSIVCSINYKKYDAEKGSKLLQIAIIVTIIAFVLNLLAYLGLR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS01290 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]