From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS01885 [old locus tag: NWMN_0332 ]
  • pan locus tag?: SAUPAN001876000
  • symbol: NWMN_RS01885
  • pan gene symbol?:
  • synonym:
  • product: NAD(P)H-dependent oxidoreductase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS01885 [old locus tag: NWMN_0332 ]
  • symbol: NWMN_RS01885
  • product: NAD(P)H-dependent oxidoreductase
  • replicon: chromosome
  • strand: +
  • coordinates: 382711..383277
  • length: 567
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (382711..383277) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAATATTGTATTATTGTCAGGTTCCACAGTAGGTTCTAAAACGAGAATTGCTATGGAT
    GATTTAAAAAATGAACTAGAAGTCATCAATGAGGGACATCAAATAGAGTTGATGGATTTA
    CGAGAACTTGAATTAGAATTTAGCGTTGGAAAGAATTATCTAGATACTACAGGAGATGTA
    TATAAATTAACGACGTCGTTAATGCAGGCTGATGTGATTTTTATTGGTTTTCCAATTTTT
    CAAGCTTCCATCCCTGGTGCTTTGAAAAATGTGTTTGATCTACTTCCAGTCAATGCGTTT
    CGTGACAAGGTAATAGGACTTGTAGCGACAGCAGGTTCTAGTAAACATTATTTAATTCCT
    GAAATGCATTTAAAACCAATATTGAGTTACATGAAAGCACATACGATGCAAACGTATGTA
    TTTATTGAAGAGAAAGATTTTTCAAATCAACAAATTGTCAATGATGATGTTGTATTTCGG
    TTAAAAGCGTTGGCACAATCCACAATGCGAACTGCCAAAGTACAACAACAAGTGTTTGAA
    GAAGAAAACAACCAATACGACTTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    567

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS01885 [old locus tag: NWMN_0332 ]
  • symbol: NWMN_RS01885
  • description: NAD(P)H-dependent oxidoreductase
  • length: 188
  • theoretical pI: 4.73212
  • theoretical MW: 21314.4
  • GRAVY: -0.0611702

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    FMN reductase (TIGR03566; EC 1.5.1.-; HMM-score: 96)
    MetabolismCentral intermediary metabolismSulfur metabolismFMN reductase (TIGR03567; EC 1.5.1.38; HMM-score: 88.8)
    LLM-partnered FMN reductase, CE1759 family (TIGR04037; EC 1.-.-.-; HMM-score: 81.4)
  • TheSEED:
  • PFAM:
    Flavoprotein (CL0042) FMN_red; NADPH-dependent FMN reductase (PF03358; HMM-score: 91.9)
    Flavodoxin_2; Flavodoxin-like fold (PF02525; HMM-score: 32.1)
    Flavodoxin_4; Flavodoxin (PF12682; HMM-score: 14.9)
    no clan definedReceptor_IA-2; Protein-tyrosine phosphatase receptor IA-2 (PF11548; HMM-score: 11.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.193
    • Ymax_pos: 19
    • Cmax: 0.167
    • Cmax_pos: 19
    • Smax: 0.399
    • Smax_pos: 17
    • Smean: 0.242
    • D: 0.212
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446951175 NCBI
  • RefSeq: WP_001028431 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNIVLLSGSTVGSKTRIAMDDLKNELEVINEGHQIELMDLRELELEFSVGKNYLDTTGDVYKLTTSLMQADVIFIGFPIFQASIPGALKNVFDLLPVNAFRDKVIGLVATAGSSKHYLIPEMHLKPILSYMKAHTMQTYVFIEEKDFSNQQIVNDDVVFRLKALAQSTMRTAKVQQQVFEEENNQYDF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS01885 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]