From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS01935
  • pan locus tag?:
  • symbol: NWMN_RS01935
  • pan gene symbol?:
  • synonym:
  • product: transcriptional regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS01935
  • symbol: NWMN_RS01935
  • product: transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 391156..391359
  • length: 204
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (391156..391359) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    GTGCGTAATCGATTGAAAGAATTACGAGCACGAGATGGCTTAAACCAAACGCAACTTGCT
    AAACAAGCGGGCGTTTCAAGACAAACCATATCGCTAATTGAGCGAAACAATTTTATGCCA
    TCAGTATTAACGGCAATAAAAATTGCTCGCATTTTCAATGAAACGGTGGAAACTGTTTTT
    ATTATTGAGGAGGATGAGGCATGA
    60
    120
    180
    204

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS01935
  • symbol: NWMN_RS01935
  • description: transcriptional regulator
  • length: 67
  • theoretical pI: 9.43033
  • theoretical MW: 7688.8
  • GRAVY: -0.304478

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, y4mF family (TIGR03070; HMM-score: 33.5)
    Genetic information processingMobile and extrachromosomal element functionsOtheraddiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)
    Signal transductionRegulatory functionsDNA interactionsaddiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)
    Signal transductionRegulatory functionsProtein interactionsaddiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)
    Signal transductionRegulatory functionsDNA interactionsDNA-binding protein, Tfx family (TIGR00721; HMM-score: 20.3)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 18)
    Unknown functionGeneralmobile mystery protein A (TIGR02612; HMM-score: 17.5)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14.6)
  • TheSEED:
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 56.5)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 46)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 35.4)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 26.4)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 22.6)
    HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 22.6)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 19.7)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 18.9)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 18.4)
    MarR_2; MarR family (PF12802; HMM-score: 18.4)
    LacI; Bacterial regulatory proteins, lacI family (PF00356; HMM-score: 18.3)
    HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 18.2)
    MarR; MarR family (PF01047; HMM-score: 17)
    HTH_11; HTH domain (PF08279; HMM-score: 17)
    Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 15.9)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 14.1)
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.9)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 13.9)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 13.6)
    no clan definedTnsD; Tn7-like transposition protein D (PF15978; HMM-score: 13.4)
    HTH (CL0123) YdaS_antitoxin; Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT (PF15943; HMM-score: 12.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.154
    • Ymax_pos: 11
    • Cmax: 0.119
    • Cmax_pos: 23
    • Smax: 0.326
    • Smax_pos: 1
    • Smean: 0.222
    • D: 0.18
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447168757 NCBI
  • RefSeq: WP_001246013 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MRNRLKELRARDGLNQTQLAKQAGVSRQTISLIERNNFMPSVLTAIKIARIFNETVETVFIIEEDEA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS01935 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]