From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS02380 [old locus tag: NWMN_0421 ]
  • pan locus tag?: SAUPAN002168000
  • symbol: NWMN_RS02380
  • pan gene symbol?:
  • synonym:
  • product: phosphatase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS02380 [old locus tag: NWMN_0421 ]
  • symbol: NWMN_RS02380
  • product: phosphatase
  • replicon: chromosome
  • strand: +
  • coordinates: 472587..473261
  • length: 675
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (472587..473261) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGATAGATAAAAAATTAACATCACCGAAAATGACAGTGCCTTTATTTTTAATCGCGCTG
    ATTGTATTTATAGGTATGTTTTACAGTGTAGTGACAAATCAAGAATGGCTTAAAAATATA
    GATATGGGATCATTAACATGGTTTACAGATTATTTCGGTGAGCCACAACGTCAGTATGTT
    AACAATTTATTTAATTACTATATGACGTTTAGTGCGGAAATTGGAGATGTCAAAGGTGTC
    GTGTTGATTTCCATTATCGTCACAATCATACTGTTTATTAAACAGAGGCATTTAGCGGTT
    TGGTTTGTGACATATTTGGTTTCAGGTGTCATCATGAACAAATTAATTAAAGATACTGTT
    TTACGTCCAAGACCATATAATCATTTAGCCGTTGATACAGGCTTTTCATTTCCAAGTGGA
    CATTCCAACGCCAGCACATTATTATATTTCGCTTTAATGATCATAATTATTTCACTTGCT
    GCTAAGACAATAACAAAAGTGTTGAGTGCGCTAGTTATGGGAATATTATGGCTTAGCATA
    TTATTTTGTCGCCTTTATTTTCATGCGCATTACTTTTCAGATGTCATTGGCGGCACGTCA
    CTAGCAATCATTTGGGTAGCGTTATTCTTAATGGTATACCCATACTTTATTAATCATCGA
    CGACAACGCGTTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    675

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS02380 [old locus tag: NWMN_0421 ]
  • symbol: NWMN_RS02380
  • description: phosphatase
  • length: 224
  • theoretical pI: 9.93343
  • theoretical MW: 25755.6
  • GRAVY: 0.698214

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein and peptide secretion and traffickingheme exporter protein CcmB (TIGR01190; HMM-score: 14.2)
    MetabolismTransport and binding proteinsOtherheme exporter protein CcmB (TIGR01190; HMM-score: 14.2)
  • TheSEED:
  • PFAM:
    pap2 (CL0525) PAP2; PAP2 superfamily (PF01569; HMM-score: 50.7)
    PAP2_3; PAP2 superfamily (PF14378; HMM-score: 17.3)
    no clan definedDUF3671; Protein of unknown function (PF12420; HMM-score: 10.6)
    Fijivirus_P9-2; Fijivirus P9-2 protein (PF06837; HMM-score: 8.6)
    ABC-2 (CL0181) CcmB; CcmB protein (PF03379; HMM-score: 7.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.213
    • Ymax_pos: 11
    • Cmax: 0.137
    • Cmax_pos: 40
    • Smax: 0.568
    • Smax_pos: 4
    • Smean: 0.445
    • D: 0.304
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit source | edit]

  • GI: 446487966 NCBI
  • RefSeq: WP_000565820 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MIDKKLTSPKMTVPLFLIALIVFIGMFYSVVTNQEWLKNIDMGSLTWFTDYFGEPQRQYVNNLFNYYMTFSAEIGDVKGVVLISIIVTIILFIKQRHLAVWFVTYLVSGVIMNKLIKDTVLRPRPYNHLAVDTGFSFPSGHSNASTLLYFALMIIIISLAAKTITKVLSALVMGILWLSILFCRLYFHAHYFSDVIGGTSLAIIWVALFLMVYPYFINHRRQRV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS02380 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]