From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS02415 [old locus tag: NWMN_0427 ]
  • pan locus tag?: SAUPAN002177000
  • symbol: NWMN_RS02415
  • pan gene symbol?: metP2
  • synonym:
  • product: ABC transporter permease

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS02415 [old locus tag: NWMN_0427 ]
  • symbol: NWMN_RS02415
  • product: ABC transporter permease
  • replicon: chromosome
  • strand: +
  • coordinates: 479404..480063
  • length: 660
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (479404..480063) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGTTTGGTTCTGATTTAGACAGTGCACAGTTATTACAAGCATTGTACGAAACGCTATAT
    ATGGTATCTATTGCTTTATTTTTAGGAGCAGTGATTGGTATTCCATTAGGTGTCTTATTG
    GTAATTACTCGAAAACAAGGCATATGGCCCAATATAGTGATACATCAAGTTTTAAATCCT
    TTAATCAATATTTTAAGGTCACTACCATTTATTATTTTGTTAATTGCGATTGTGCCATTC
    ACAAAATTAGTAGTAGGTACTTCAATTGGTACGACTGCTGCCATCGTGCCTTTAACAGTA
    TATGTGGCACCTTACATTGCAAGACTTGTTGAAAACTCATTATTGGAAGTAGACGAGGGG
    ATTATTGAAGCGGCGAAAGCGATGGGCGCTTCACCACTACAAATCATTAGATATTTTTTA
    ATTCCTGAAGCTTTAGGTTCGTTAGTATTAGCAATTACCACTGCGATTATTGGACTTATT
    GGAAGTACGGCGATGGCAGGAGCTGTTGGCGGTGGTGGTATAGGAGACTTAGCTTTAGTG
    TATGGTTATCAAAGATTTGATACGACGGTCATTATTATTACCGTTATTGTATTAGTCATT
    ATTGTCCAAGTGATTCAAACGCTAGGGAATGTTCTAGCTAGATTCATACGTAGACATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS02415 [old locus tag: NWMN_0427 ]
  • symbol: NWMN_RS02415
  • description: ABC transporter permease
  • length: 219
  • theoretical pI: 7.66251
  • theoretical MW: 23309.9
  • GRAVY: 1.15479

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsAnionsphosphonate ABC transporter, permease protein PhnE (TIGR01097; HMM-score: 73.4)
    choline ABC transporter, permease protein (TIGR03416; HMM-score: 38.3)
    ectoine/hydroxyectoine ABC transporter, permease protein EhuD (TIGR03003; HMM-score: 33.2)
    MetabolismTransport and binding proteinsAnionsphosphate ABC transporter, permease protein PstA (TIGR00974; HMM-score: 31.8)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesamino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family (TIGR01726; HMM-score: 22.7)
    MetabolismTransport and binding proteinsAnionsphosphate ABC transporter, permease protein PstC (TIGR02138; HMM-score: 21.9)
    ectoine/hydroxyectoine ABC transporter, permease protein EhuC (TIGR03004; HMM-score: 20.3)
    NifC-like ABC-type porter (TIGR01581; HMM-score: 19)
    2-aminoethylphosphonate ABC transporter, permease protein (TIGR03226; HMM-score: 18.4)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel ABC transporter, permease subunit NikB (TIGR02789; EC 3.6.3.24; HMM-score: 18.2)
    MetabolismTransport and binding proteinsAnionssulfate ABC transporter, permease protein CysT (TIGR02139; HMM-score: 16.6)
    MetabolismTransport and binding proteinsAnionsmolybdate ABC transporter, permease protein (TIGR02141; HMM-score: 14.8)
  • TheSEED:
  • PFAM:
    BPD_transp_1 (CL0404) BPD_transp_1; Binding-protein-dependent transport system inner membrane component (PF00528; HMM-score: 71.6)
    FtsX; FtsX-like permease family (PF02687; HMM-score: 7.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.114
    • Ymax_pos: 48
    • Cmax: 0.153
    • Cmax_pos: 48
    • Smax: 0.121
    • Smax_pos: 44
    • Smean: 0.052
    • D: 0.09
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit source | edit]

  • GI: 446390139 NCBI
  • RefSeq: WP_000467994 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MFGSDLDSAQLLQALYETLYMVSIALFLGAVIGIPLGVLLVITRKQGIWPNIVIHQVLNPLINILRSLPFIILLIAIVPFTKLVVGTSIGTTAAIVPLTVYVAPYIARLVENSLLEVDEGIIEAAKAMGASPLQIIRYFLIPEALGSLVLAITTAIIGLIGSTAMAGAVGGGGIGDLALVYGYQRFDTTVIIITVIVLVIIVQVIQTLGNVLARFIRRH

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS02415 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]