From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS02600 [old locus tag: NWMN_0455 ]
  • pan locus tag?: SAUPAN002229000
  • symbol: NWMN_RS02600
  • pan gene symbol?: rnmV
  • synonym:
  • product: ribonuclease M5

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS02600 [old locus tag: NWMN_0455 ]
  • symbol: NWMN_RS02600
  • product: ribonuclease M5
  • replicon: chromosome
  • strand: +
  • coordinates: 518606..519142
  • length: 537
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (518606..519142) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAAAATCAATGAGTTTATAGTTGTAGAAGGACGAGATGATACTGAGCGTGTTAAACGA
    GCTGTTGAATGTGATACGATTGAAACGAATGGTAGTGCCATCAACGAACAAACTTTAGAA
    GTAATTAGAAATGCTCAACAAAGTCGAGGCGTTATTGTATTAACAGATCCAGATTTCCCA
    GGAGATAAAATTAGAAGTACAATTACTGAACATGTCAAAGGTGTTAAACATGCGTATATT
    GATAGAGAAAAAGCTAAAAATAAAAAAGGGAAAATTGGTGTTGAACATGCCGACTTAATT
    GATATTAAAGAAGCGTTAATGCATGTTAGTTCACCCTTTGATGAAGCTTATGAATCAATT
    GATAAATCTGTGCTAATAGAGTTGGGGTTAATTGTTGGGAAAGATGCAAGGCGCCGTAGA
    GAAATTTTAAGTAGAAAATTGCGAATCGGCCATTCCAATGGTAAGCAGTTATTGAAAAAG
    TTAAATGCATTTGGTTATACCGAAGCGGATGTAAGGCAAGCTTTAGAAGATGAATGA
    60
    120
    180
    240
    300
    360
    420
    480
    537

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS02600 [old locus tag: NWMN_0455 ]
  • symbol: NWMN_RS02600
  • description: ribonuclease M5
  • length: 178
  • theoretical pI: 7.07882
  • theoretical MW: 20091.7
  • GRAVY: -0.57191

Function[edit source | edit]

  • reaction:
    EC 3.1.26.8?  ExPASy
    Ribonuclease M5Endonucleolytic cleavage of RNA, removing 21 and 42 nucleotides, respectively, from the 5'- and 3'-termini of a 5S-rRNA precursor
  • TIGRFAM:
    Genetic information processingTranscriptionRNA processingribonuclease M5 (TIGR00334; EC 3.1.26.8; HMM-score: 179.9)
  • TheSEED:
  • PFAM:
    no clan definedDUF4093; Domain of unknown function (DUF4093) (PF13331; HMM-score: 86.7)
    Toprim-like (CL0413) Toprim; Toprim domain (PF01751; HMM-score: 25)
    Toprim_4; Toprim domain (PF13662; HMM-score: 18.7)
    Toprim_2; Toprim-like (PF13155; HMM-score: 14.7)
    no clan definedpKID; pKID domain (PF02173; HMM-score: 12.7)
    STIR (CL0173) TIR-like; Predicted nucleotide-binding protein containing TIR-like domain (PF10137; HMM-score: 12.5)
    UBA (CL0214) UBA; UBA/TS-N domain (PF00627; HMM-score: 11.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.099
    • Ymax_pos: 23
    • Cmax: 0.111
    • Cmax_pos: 48
    • Smax: 0.141
    • Smax_pos: 19
    • Smean: 0.087
    • D: 0.094
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446622734 NCBI
  • RefSeq: WP_000700080 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKINEFIVVEGRDDTERVKRAVECDTIETNGSAINEQTLEVIRNAQQSRGVIVLTDPDFPGDKIRSTITEHVKGVKHAYIDREKAKNKKGKIGVEHADLIDIKEALMHVSSPFDEAYESIDKSVLIELGLIVGKDARRRREILSRKLRIGHSNGKQLLKKLNAFGYTEADVRQALEDE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS02600 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]