From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS02660 [old locus tag: NWMN_0465 ]
  • pan locus tag?: SAUPAN002243000
  • symbol: NWMN_RS02660
  • pan gene symbol?: pth
  • synonym:
  • product: peptidyl-tRNA hydrolase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS02660 [old locus tag: NWMN_0465 ]
  • symbol: NWMN_RS02660
  • product: peptidyl-tRNA hydrolase
  • replicon: chromosome
  • strand: +
  • coordinates: 527098..527670
  • length: 573
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (527098..527670) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAATGTATTGTAGGTCTAGGTAATATAGGTAAACGTTTTGAACTTACAAGACATAAT
    ATCGGCTTTGAAGTCGTTGATTATATTTTAGAGAAAAATAATTTTTCATTAGATAAACAA
    AAGTTTAAAGGTGCATATACAATTGAACGAATGAACGGCGATAAAGTGTTATTTATCGAA
    CCAATGACAATGATGAATTTGTCAGGTGAAGCAGTTGCACCGATTATGGATTATTACAAT
    GTTAATCCAGAAGATTTAATTGTCTTATATGATGATTTAGATTTAGAACAAGGACAAGTT
    CGCTTAAGACAAAAAGGAAGTGCGGGCGGTCACAATGGTATGAAATCAATTATTAAAATG
    CTTGGTACAGACCAATTTAAACGTATTCGTATTGGTGTGGGAAGACCAACGAATGGTATG
    ACGGTACCTGATTATGTTTTACAACGCTTTTCAAATGATGAAATGGTAACGATGGAAAAA
    GTTATCGAACACGCAGCACGCGCAATTGAAAAGTTTGTTGAAACATCACGATTTGACCAT
    GTTATGAATGAATTTAATGGTGAAGTGAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    573

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS02660 [old locus tag: NWMN_0465 ]
  • symbol: NWMN_RS02660
  • description: peptidyl-tRNA hydrolase
  • length: 190
  • theoretical pI: 6.52772
  • theoretical MW: 21702.9
  • GRAVY: -0.344211

Function[edit source | edit]

  • reaction:
    EC 3.1.1.29?  ExPASy
    Aminoacyl-tRNA hydrolaseN-substituted aminoacyl-tRNA + H2O = N-substituted amino acid + tRNA
  • TIGRFAM:
    Genetic information processingProtein synthesisOtheraminoacyl-tRNA hydrolase (TIGR00447; EC 3.1.1.29; HMM-score: 214.1)
  • TheSEED:
  • PFAM:
    no clan definedPept_tRNA_hydro; Peptidyl-tRNA hydrolase (PF01195; HMM-score: 192.3)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.121
    • Ymax_pos: 13
    • Cmax: 0.11
    • Cmax_pos: 45
    • Smax: 0.172
    • Smax_pos: 2
    • Smean: 0.142
    • D: 0.129
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446572445 NCBI
  • RefSeq: WP_000649791 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKCIVGLGNIGKRFELTRHNIGFEVVDYILEKNNFSLDKQKFKGAYTIERMNGDKVLFIEPMTMMNLSGEAVAPIMDYYNVNPEDLIVLYDDLDLEQGQVRLRQKGSAGGHNGMKSIIKMLGTDQFKRIRIGVGRPTNGMTVPDYVLQRFSNDEMVTMEKVIEHAARAIEKFVETSRFDHVMNEFNGEVK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS02660 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65

Relevant publications[edit source | edit]