From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS04530 [old locus tag: NWMN_0801 ]
  • pan locus tag?: SAUPAN003028000
  • symbol: NWMN_RS04530
  • pan gene symbol?:
  • synonym:
  • product: D-glycerate dehydrogenase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS04530 [old locus tag: NWMN_0801 ]
  • symbol: NWMN_RS04530
  • product: D-glycerate dehydrogenase
  • replicon: chromosome
  • strand: +
  • coordinates: 889526..890485
  • length: 960
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (889526..890485) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    TTGGTAAAAATAGTTGTTTCGAGGAAAATTCCAGATAAATTTTATCAACAATTAAGTAAA
    CTTGGTGACGTTGTTATGTGGCAAAAATCATTAGTGCCTATGCCTAAAGATCAATTTGTG
    ACAGCACTTCGTGACGCAGATGCTTGTTTTATTACATTAAGTGAACAGATCGATGCAGAA
    ATTTTAGCGCAATCACCAAATTTAAAAGTAATTGCGAATATGGCTGTAGGATATGACAAC
    ATCGATGTTGAAAGTGCAACAGCGAATAACGTGGTTGTCACGAATACACCAAATGTACTT
    ACTGAAACAACTGCAGAATTAGGATTTACATTAATGCTTGCTATAGCACGCCGTATTGTA
    GAAGCTGAAAAATATGTAGAAGCAGATGCATGGCAAAGCTGGGGTCCTTATTTATTGTCA
    GGTAAAGATGTCTTCAATTCAACTATTGGAATATATGGTATGGGAGATATTGGTAAAGCT
    TTTGCAAGAAGGTTGCAAGGGTTTAATACTAATATTCTTTATCATAATCGATCAAGACAT
    AAAGATGCAGAGGCGGACTTTAATGCAACATATGTTTCTTTTGAAACGTTGTTAGCAGAA
    AGTGATTTTATCATCTGTACAGCGCCACTTACAAAAGAAACACATCATAAATTTAATGCT
    GAAGCATTTGAACAAATGAAAAATGATGCAATTTTTATTAATATCGGTAGAGGACAAATT
    GTAGATGAAACAGCATTAATCGATGCACTAGACAATAAAGAAATTTTAGCATGTGGTTTA
    GATGTATTAGCAAATGAACCGATTGATCATACACATCCATTAATGGGACGTGATAATGTT
    CTGATTACACCACACATTGGTAGCGCATCAGTAACAACACGGGACAATATGATTCAATTA
    TGTATTAATAATATAGAAGCGGTTATGACAAATCAGGTACCACATACTCCAGTAAATTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS04530 [old locus tag: NWMN_0801 ]
  • symbol: NWMN_RS04530
  • description: D-glycerate dehydrogenase
  • length: 319
  • theoretical pI: 4.74512
  • theoretical MW: 35357.1
  • GRAVY: -0.0435737

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismAmino acid biosynthesisSerine familyphosphoglycerate dehydrogenase (TIGR01327; EC 1.1.1.95; HMM-score: 213.3)
    MetabolismEnergy metabolismAmino acids and aminesadenosylhomocysteinase (TIGR00936; EC 3.3.1.1; HMM-score: 21.5)
    Cellular processesCellular processesSporulation and germinationdipicolinic acid synthetase, A subunit (TIGR02853; HMM-score: 17.5)
  • TheSEED:
  • PFAM:
    NADP_Rossmann (CL0063) 2-Hacid_dh_C; D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain (PF02826; HMM-score: 208.8)
    Form_Glyc_dh (CL0325) 2-Hacid_dh; D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain (PF00389; HMM-score: 105.6)
    NADP_Rossmann (CL0063) NAD_binding_2; NAD binding domain of 6-phosphogluconate dehydrogenase (PF03446; HMM-score: 27.2)
    F420_oxidored; NADP oxidoreductase coenzyme F420-dependent (PF03807; HMM-score: 24)
    AdoHcyase_NAD; S-adenosyl-L-homocysteine hydrolase, NAD binding domain (PF00670; HMM-score: 22.2)
    IlvN; Acetohydroxy acid isomeroreductase, NADPH-binding domain (PF07991; HMM-score: 14.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.13
    • Ymax_pos: 16
    • Cmax: 0.128
    • Cmax_pos: 49
    • Smax: 0.214
    • Smax_pos: 9
    • Smean: 0.166
    • D: 0.144
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446161276 NCBI
  • RefSeq: WP_000239131 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MVKIVVSRKIPDKFYQQLSKLGDVVMWQKSLVPMPKDQFVTALRDADACFITLSEQIDAEILAQSPNLKVIANMAVGYDNIDVESATANNVVVTNTPNVLTETTAELGFTLMLAIARRIVEAEKYVEADAWQSWGPYLLSGKDVFNSTIGIYGMGDIGKAFARRLQGFNTNILYHNRSRHKDAEADFNATYVSFETLLAESDFIICTAPLTKETHHKFNAEAFEQMKNDAIFINIGRGQIVDETALIDALDNKEILACGLDVLANEPIDHTHPLMGRDNVLITPHIGSASVTTRDNMIQLCINNIEAVMTNQVPHTPVN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS04530 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]