From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS05535 [old locus tag: NWMN_0987 ]
  • pan locus tag?: SAUPAN003351000
  • symbol: NWMN_RS05535
  • pan gene symbol?: rsmD
  • synonym:
  • product: methyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS05535 [old locus tag: NWMN_0987 ]
  • symbol: NWMN_RS05535
  • product: methyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 1095617..1096159
  • length: 543
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1095617..1096159) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGCGCGTCATTGCAGGTAAACATAAAAGTAAAGCTTTAGAAAGTATGGAAGGCCGTAAT
    ACGAGACCAACTATGGATAAAGTTAAAGAAGGTATCTTTAATAGTTTATATGATGTGTCA
    GGTATAGGTTTAGATTTATTTGCAGGAAGCGGGGCGCTTGGAATAGAAGCACTCTCTCGA
    GGTATGGATAAGGTAATCTTTGTTGATCAAAATTTTAAAGCTGTAAAAGTTATTAAATCA
    AATCTTGCGAATTTGGATTTAGAGGCACAATCTGAAGTTTATAAAAATAATGCAGATAGA
    GCTTTAAAAGCATTGTCAAAACGTGATATTCAATTTGATGTCATTTTCTTAGATCCACCT
    TATAATAAAGGTCTCATTGATAAAGCTTTAAAACTAATTTCAGAGTTTAATTTATTGAAA
    GAAAATGGTATCATCGTTTGTGAATTTAGCAATCATGAAGAAATAGATTATCAACCGTTT
    AATATGATTAAACGTTACCATTATGGGTTGACAGACACATTGTTATTAGAAAAGGGAGAA
    TAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    543

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS05535 [old locus tag: NWMN_0987 ]
  • symbol: NWMN_RS05535
  • description: methyltransferase
  • length: 180
  • theoretical pI: 6.80255
  • theoretical MW: 20246.2
  • GRAVY: -0.253889

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modification16S rRNA (guanine(966)-N(2))-methyltransferase RsmD (TIGR00095; EC 2.1.1.171; HMM-score: 167.8)
    Genetic information processingProtein fateProtein modification and repairprotein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 34)
    Genetic information processingProtein fateProtein modification and repairmethyltransferase, HemK family (TIGR00536; HMM-score: 33.2)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationprotein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 30.3)
    Genetic information processingProtein synthesistRNA and rRNA base modification23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 27.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminprecorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 26.1)
    Genetic information processingProtein synthesistRNA and rRNA base modificationN2,N2-dimethylguanosine tRNA methyltransferase (TIGR00308; EC 2.1.1.-; HMM-score: 24.3)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein L11 methyltransferase (TIGR00406; EC 2.1.1.-; HMM-score: 23)
    Genetic information processingDNA metabolismRestriction/modificationtype II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family (TIGR02987; EC 2.1.1.72; HMM-score: 20.2)
    Hypothetical proteinsConservedputative methyltransferase, TIGR01177 family (TIGR01177; HMM-score: 19.9)
    Unknown functionEnzymes of unknown specificityputative methylase (TIGR00537; HMM-score: 14.4)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA (uracil(54)-C(5))-methyltransferase (TIGR02143; EC 2.1.1.35; HMM-score: 13.2)
  • TheSEED:
  • PFAM:
    NADP_Rossmann (CL0063) Cons_hypoth95; Conserved hypothetical protein 95 (PF03602; HMM-score: 178)
    MTS; Methyltransferase small domain (PF05175; HMM-score: 37)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 30.1)
    Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 26.6)
    MethyltransfD12; D12 class N6 adenine-specific DNA methyltransferase (PF02086; HMM-score: 25.9)
    TRM; N2,N2-dimethylguanosine tRNA methyltransferase (PF02005; HMM-score: 25)
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 22.7)
    PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 21.2)
    Methyltransf_24; Methyltransferase domain (PF13578; HMM-score: 18.4)
    UPF0020; Putative RNA methylase family UPF0020 (PF01170; HMM-score: 15.5)
    RsmJ; Ribosomal RNA large subunit methyltransferase D, RlmJ (PF04378; HMM-score: 15.4)
    N6_N4_Mtase; DNA methylase (PF01555; HMM-score: 15.4)
    Methyltr_RsmB-F; 16S rRNA methyltransferase RsmB/F (PF01189; HMM-score: 13.9)
    Methyltransf_16; Lysine methyltransferase (PF10294; HMM-score: 13.1)
    tRNA_U5-meth_tr; tRNA (Uracil-5-)-methyltransferase (PF05958; HMM-score: 13)
    Met_10; Met-10+ like-protein (PF02475; HMM-score: 13)
    Methyltransf_3; O-methyltransferase (PF01596; HMM-score: 12.8)
    Spermine_synth; Spermine/spermidine synthase domain (PF01564; HMM-score: 12.6)
    N6-adenineMlase; Probable N6-adenine methyltransferase (PF10237; HMM-score: 12.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.157
    • Ymax_pos: 11
    • Cmax: 0.115
    • Cmax_pos: 58
    • Smax: 0.32
    • Smax_pos: 2
    • Smean: 0.232
    • D: 0.186
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447186540 NCBI
  • RefSeq: WP_001263796 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MRVIAGKHKSKALESMEGRNTRPTMDKVKEGIFNSLYDVSGIGLDLFAGSGALGIEALSRGMDKVIFVDQNFKAVKVIKSNLANLDLEAQSEVYKNNADRALKALSKRDIQFDVIFLDPPYNKGLIDKALKLISEFNLLKENGIIVCEFSNHEEIDYQPFNMIKRYHYGLTDTLLLEKGE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS05535 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]