From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS05620 [old locus tag: NWMN_0998 ]
  • pan locus tag?: SAUPAN001670000
  • symbol: NWMN_RS05620
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS05620 [old locus tag: NWMN_0998 ]
  • symbol: NWMN_RS05620
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1105075..1105554
  • length: 480
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1105075..1105554) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGCTAATCTATATGAGCTATCAGAAGCATTTAAAGAGATGTCTAATCAAGATGAATTA
    GATCCAACATTACTAAAAGATACATTAGATTCTATCAAAGCAGAAATGAACGTCAAAGTA
    GATAACATTGTCAATTGGAGACGTGAAACTTTAGGTGACATAGATGTCATAGATAAAGAA
    ATTAAGAGACTTCAAAATTTAAAAAAACAAAAACAAAATTTAACTGATCGTTTAAGAGAT
    TACTTAAAAGAGATGTTAGAAACACAGGAAGTAGATAGTTACCGCACAGCTACTAATCAT
    ATTTACAAGCGCAAAAACGGGGCTAGTAAAAATATTATCGATGAAAAACTTATTCCAAAG
    GATTATTGGCTATCACAAGCGCCAAAGCTTAATTCTAAGCAACTAATCGATGATTTGAAA
    GCTGGCAAAGATATTCCGGGCGCTGAATTAAAGGTAACGGAAAGTTTGGTGATTAAGTGA
    60
    120
    180
    240
    300
    360
    420
    480

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS05620 [old locus tag: NWMN_0998 ]
  • symbol: NWMN_RS05620
  • description: hypothetical protein
  • length: 159
  • theoretical pI: 6.04495
  • theoretical MW: 18478
  • GRAVY: -0.787421

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesPathogenesisphospholipase C, phosphocholine-specific (TIGR03396; EC 3.1.4.3; HMM-score: 10.4)
  • TheSEED:
  • PFAM:
    no clan definedSipho_Gp157; Siphovirus Gp157 (PF05565; HMM-score: 120.6)
    NICE-3; NICE-3 protein (PF07406; HMM-score: 18.6)
    HAUS-augmin3; HAUS augmin-like complex subunit 3 (PF14932; HMM-score: 17.6)
    Cystatin (CL0121) YPEB; YpeB sporulation (PF14620; HMM-score: 15.3)
    TPR (CL0020) ParcG; Parkin co-regulated protein (PF10274; HMM-score: 14.2)
    no clan definedDNA_repr_REX1B; DNA repair REX1-B (PF14966; HMM-score: 13.9)
    HTH (CL0123) DUF2316; Uncharacterized protein conserved in bacteria (DUF2316) (PF10078; HMM-score: 13.1)
    no clan definedEcoEI_R_C; EcoEI R protein C-terminal (PF08463; HMM-score: 12.9)
    Osmo_CC; Osmosensory transporter coiled coil (PF08946; HMM-score: 12.6)
    Phage_Mu_Gam; Bacteriophage Mu Gam like protein (PF07352; HMM-score: 12.5)
    S15_NS1 (CL0600) WHEP-TRS; WHEP-TRS domain (PF00458; HMM-score: 11.5)
    no clan definedFib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 10.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.099
    • Ymax_pos: 70
    • Cmax: 0.109
    • Cmax_pos: 18
    • Smax: 0.114
    • Smax_pos: 34
    • Smean: 0.08
    • D: 0.091
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 445924661 NCBI
  • RefSeq: WP_000002516 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MANLYELSEAFKEMSNQDELDPTLLKDTLDSIKAEMNVKVDNIVNWRRETLGDIDVIDKEIKRLQNLKKQKQNLTDRLRDYLKEMLETQEVDSYRTATNHIYKRKNGASKNIIDEKLIPKDYWLSQAPKLNSKQLIDDLKAGKDIPGAELKVTESLVIK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS05620 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]