From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS05850
  • pan locus tag?:
  • symbol: NWMN_RS05850
  • pan gene symbol?:
  • synonym:
  • product: XkdX family protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS05850
  • symbol: NWMN_RS05850
  • product: XkdX family protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1135294..1135467
  • length: 174
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1135294..1135467) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGAAGATGATTTATCCAACTTTTAAAGACATTAAAACTTTTTATGTGTGGGGTTGCTAT
    AAAAATGAGCAAATTAAGTGGTACGTAGACATGGGTGTAATCGACAAAGAAGAATATGCA
    TTGATCACTGGTGAAAAATATCCAGAAACAAAAGATGAAAAGTCACAGGTGTAA
    60
    120
    174

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS05850
  • symbol: NWMN_RS05850
  • description: XkdX family protein
  • length: 57
  • theoretical pI: 5.00135
  • theoretical MW: 6922.96
  • GRAVY: -0.692982

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingMobile and extrachromosomal element functionsProphage functionsphage uncharacterized protein, XkdX family (TIGR01669; HMM-score: 76.2)
  • TheSEED:
  • PFAM:
    no clan definedPhage_XkdX; Phage uncharacterised protein (Phage_XkdX) (PF09693; HMM-score: 61)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0.24
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.8
    • Extracellular Score: 8.91
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.117
    • Ymax_pos: 11
    • Cmax: 0.108
    • Cmax_pos: 26
    • Smax: 0.215
    • Smax_pos: 1
    • Smean: 0.12
    • D: 0.118
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_001800921 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKMIYPTFKDIKTFYVWGCYKNEQIKWYVDMGVIDKEEYALITGEKYPETKDEKSQV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS05850 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]