From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS05855 [old locus tag: NWMN_1034 ]
  • pan locus tag?: SAUPAN001701000
  • symbol: NWMN_RS05855
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS05855 [old locus tag: NWMN_1034 ]
  • symbol: NWMN_RS05855
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1135508..1135807
  • length: 300
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1135508..1135807) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGTTTGGATTTACCAAACGACACGAACAAGATTGGCGTTTAACGCGATTAGAAGAAAAT
    GATAAGACTATGTTTGAAAAATTCGACAGAATAGAAGACAGTCTGAGAACGCAAGAAAAA
    ATTTATGACAAGTTAGATAGAAATTTCGAAGAACTAAGGCGTGACAAGGTAGAAGATGAA
    AAGAATAAAGAAAAGAATGCTAAGAATATTAGAGACATAAAAATGTGGATTCTCGGTTTG
    ATAGGGACTATCTTCAGTACGATTGTCATAGCTTTACTAAGAACTATTTTTGGTATTTAA
    60
    120
    180
    240
    300

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS05855 [old locus tag: NWMN_1034 ]
  • symbol: NWMN_RS05855
  • description: hypothetical protein
  • length: 99
  • theoretical pI: 9.03807
  • theoretical MW: 12082.8
  • GRAVY: -0.765657

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismOtherMutS2 family protein (TIGR01069; HMM-score: 8.3)
  • TheSEED:
  • PFAM:
    no clan definedDUF2951; Protein of unknown function (DUF2951) (PF11166; HMM-score: 181.6)
    XhlA; Haemolysin XhlA (PF10779; HMM-score: 15.4)
    Vps51 (CL0295) Sec3_C_2; Sec3 exocyst complex subunit (PF15278; HMM-score: 14.7)
    no clan definedTelA; Toxic anion resistance protein (TelA) (PF05816; HMM-score: 13.3)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 12.2)
    DUF3452; Domain of unknown function (DUF3452) (PF11934; HMM-score: 12.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.78
    • Cytoplasmic Membrane Score: 8.16
    • Cellwall Score: 0.06
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.109
    • Ymax_pos: 67
    • Cmax: 0.101
    • Cmax_pos: 4
    • Smax: 0.129
    • Smax_pos: 59
    • Smean: 0.091
    • D: 0.102
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 446388932 NCBI
  • RefSeq: WP_000466787 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MFGFTKRHEQDWRLTRLEENDKTMFEKFDRIEDSLRTQEKIYDKLDRNFEELRRDKVEDEKNKEKNAKNIRDIKMWILGLIGTIFSTIVIALLRTIFGI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS05855 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]