From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS06700 [old locus tag: NWMN_1189 ]
  • pan locus tag?: SAUPAN003582000
  • symbol: NWMN_RS06700
  • pan gene symbol?:
  • synonym:
  • product: 3-oxoacyl-ACP reductase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS06700 [old locus tag: NWMN_1189 ]
  • symbol: NWMN_RS06700
  • product: 3-oxoacyl-ACP reductase
  • replicon: chromosome
  • strand: +
  • coordinates: 1311977..1312681
  • length: 705
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1311977..1312681) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAAGCATTAGTATTAGGTGGTTCTGGTTCAATTGGTTCTGAGATAGTCAAACAATTA
    TTAACTGATGGATTTGAAGTTTATGTGCAATATTATCGTACTGATATAAATGAATTAACT
    AGCAAATTTAATGATGATAAAGTTCGTTTTATACAAGCGGATTTATCTCAAACAATTGAT
    ATTGACAAAACATTTGGTGACATTAAATCATTAGACTGTTTAATATATGCAAGTGGTCAG
    TCTTTATATGGTGTTTTACAAGATATGAAAGACCATGATATTGATGCATGTTATCAGTTA
    AATGTCTTGCAATTAATTCGATTATGTAGATATTTCGTTGATGTTTTACGTCAAAGTGCC
    AATGGAAGAATTATTGTAATTTCATCAATTTGGGGTGAGACAGGAGCTAGTATGGAAACT
    ATTTATTCGGCGATGAAAAGTGCACAATTAGGTTTCGTTAAGGCGCTTAGTCAAGAGCTT
    GCACTAACATCAGTGACAGTAAATGCTATCGCACCTGGATTTGTAGCCGGTAATATGGCA
    AGTGAGTGGCAAGAAGATGAACTTCAAGCAATGATAACTGAATTACCACAACAGCGATTG
    GTTTTACCGAGTGAGGTTGCTCATACATGCGCCTATTTATATCACCCAAATGCTAGAAGT
    GTTACTGGAACTATACAGAAAGTTAATGGTGCTTGGTATATTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    705

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS06700 [old locus tag: NWMN_1189 ]
  • symbol: NWMN_RS06700
  • description: 3-oxoacyl-ACP reductase
  • length: 234
  • theoretical pI: 4.61995
  • theoretical MW: 25924.4
  • GRAVY: 0.0589744

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    acetoacetyl-CoA reductase (TIGR01829; EC 1.1.1.36; HMM-score: 142.7)
    MetabolismFatty acid and phospholipid metabolismBiosynthesis3-oxoacyl-[acyl-carrier-protein] reductase (TIGR01830; EC 1.1.1.100; HMM-score: 140.9)
    3-hydroxybutyrate dehydrogenase (TIGR01963; HMM-score: 97.6)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisputative 3-oxoacyl-(acyl-carrier-protein) reductase (TIGR01831; HMM-score: 85.3)
    MetabolismEnergy metabolismFermentationacetoin reductases (TIGR02415; EC 1.1.1.-; HMM-score: 85.1)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharides2-deoxy-D-gluconate 3-dehydrogenase (TIGR01832; EC 1.1.1.125; HMM-score: 81.5)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR04504; EC 1.1.99.-; HMM-score: 77.4)
    2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (TIGR04316; EC 1.3.1.28; HMM-score: 73.4)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR03971; EC 1.1.99.-; HMM-score: 67.7)
    2-hydroxycyclohexanecarboxyl-CoA dehydrogenase (TIGR03206; EC 1.1.1.-; HMM-score: 54)
    pteridine reductase (TIGR02685; EC 1.5.1.33; HMM-score: 47.2)
    cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (TIGR03325; EC 1.3.1.56; HMM-score: 46.3)
    rhamnulose-1-phosphate aldolase/alcohol dehydrogenase (TIGR02632; EC 1.1.1.1,4.1.2.19; HMM-score: 38)
    MetabolismEnergy metabolismSugarsUDP-glucose 4-epimerase GalE (TIGR01179; EC 5.1.3.2; HMM-score: 27.5)
    sepiapterin reductase (TIGR01500; EC 1.1.1.153; HMM-score: 26.6)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesdTDP-glucose 4,6-dehydratase (TIGR01181; EC 4.2.1.46; HMM-score: 16)
    hopanoid-associated sugar epimerase (TIGR03466; HMM-score: 15.9)
    ergot alkaloid biosynthesis protein, AFUA_2G17970 family (TIGR03649; HMM-score: 14.8)
    UDP-N-acetylglucosamine 4,6-dehydratase (inverting) (TIGR03589; EC 4.2.1.115; HMM-score: 14.3)
    Hypothetical proteinsConservedTIGR01777 family protein (TIGR01777; HMM-score: 13.4)
  • TheSEED:
  • PFAM:
    NADP_Rossmann (CL0063) adh_short; short chain dehydrogenase (PF00106; HMM-score: 124)
    adh_short_C2; Enoyl-(Acyl carrier protein) reductase (PF13561; HMM-score: 118)
    Epimerase; NAD dependent epimerase/dehydratase family (PF01370; HMM-score: 31.1)
    NAD_binding_10; NAD(P)H-binding (PF13460; HMM-score: 30.8)
    KR; KR domain (PF08659; HMM-score: 27.9)
    3Beta_HSD; 3-beta hydroxysteroid dehydrogenase/isomerase family (PF01073; HMM-score: 21.5)
    GDP_Man_Dehyd; GDP-mannose 4,6 dehydratase (PF16363; HMM-score: 21.5)
    NmrA; NmrA-like family (PF05368; HMM-score: 21.5)
    Polysacc_synt_2; Polysaccharide biosynthesis protein (PF02719; HMM-score: 13.6)
    RmlD_sub_bind; RmlD substrate binding domain (PF04321; HMM-score: 12.6)
    HTH (CL0123) RepL; Firmicute plasmid replication protein (RepL) (PF05732; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.138
    • Ymax_pos: 22
    • Cmax: 0.11
    • Cmax_pos: 22
    • Smax: 0.253
    • Smax_pos: 19
    • Smean: 0.166
    • D: 0.149
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446568881 NCBI
  • RefSeq: WP_000646227 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKALVLGGSGSIGSEIVKQLLTDGFEVYVQYYRTDINELTSKFNDDKVRFIQADLSQTIDIDKTFGDIKSLDCLIYASGQSLYGVLQDMKDHDIDACYQLNVLQLIRLCRYFVDVLRQSANGRIIVISSIWGETGASMETIYSAMKSAQLGFVKALSQELALTSVTVNAIAPGFVAGNMASEWQEDELQAMITELPQQRLVLPSEVAHTCAYLYHPNARSVTGTIQKVNGAWYI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS06700 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]