From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS07185 [old locus tag: NWMN_1274 ]
  • pan locus tag?: SAUPAN003751000
  • symbol: NWMN_RS07185
  • pan gene symbol?: msrR
  • synonym:
  • product: regulatory protein MsrR

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS07185 [old locus tag: NWMN_1274 ]
  • symbol: NWMN_RS07185
  • product: regulatory protein MsrR
  • replicon: chromosome
  • strand: +
  • coordinates: 1404810..1405793
  • length: 984
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1404810..1405793) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    ATGGATAAAGAAACTAATGACAACGAATATAGACGTCAAAGTGAACATCGCACTTCGGCG
    CCTAAGCGAAAAAAGAAGAAGAAAATTAGGAAATTACCTATCATTCTTCTGATTGTTGTA
    ATTTTACTTATCGCATTAGTTGTATATATTGTACATAGTTACAATAGCGGTGTAGAATAT
    GCCAAGAAACATGCGAAAGATGTTAAAGTACATCAATTTAATGGACCAGTAAAAAATGAT
    GGTAAAATTTCTATTCTTGTACTCGGTGCAGATAAAGCACAAGGTGGACAATCAAGAACA
    GATTCTATCATGGTTGTTCAATATGACTTTATCAATAAAAAGATGAAAATGATGTCTGTC
    ATGCGTGATATTTATGCAGATATTCCAGGATATGGAAAACACAAAATTAATTCAGCATAC
    GCTTTAGGTGGTCCAGAGCTACTTAGAAAAACACTTGATAAAAATTTAGGAATTAATCCT
    GAATATTATGCAGTAGTTGATTTTACTGGATTTGAGAAAATGATTGATGAATTAATGCCT
    GAAGGTGTACCAATTAATGTCGAAAAAGATATGTCGAAAAATATTGGTGTATCTTTGAAA
    AAGGGTAACCATAGGTTGAATGGTAAAGAATTACTTGGTTATGCAAGATTCCGTCACGAC
    CCTGAAGGTGACTTCGGACGCGTGCGACGTCAGCAACAAGTGATGCAAACATTGAAAAAA
    GAAATGGTTAATTTTAGAACAGTTGTTAAATTACCAAAAGTTGCAGGTATTTTAAGAGGC
    TATGTGAATACAAACATTCCTGATTCAGGGATTTTCCAAACAGGTTTGAGTTTTGGTATC
    CGAGGTGAAAAAGATGTTAAGTCATTGACTGTGCCAATCAAGAACTCATACGAAGATGTC
    AATACAAATACTGATGGTAGTGCATTACAGATTAATAAAAACACAAATAAACAAGCTATT
    AAAGACTTTTTAGATGAAGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    984

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS07185 [old locus tag: NWMN_1274 ]
  • symbol: NWMN_RS07185
  • description: regulatory protein MsrR
  • length: 327
  • theoretical pI: 10.2483
  • theoretical MW: 36970.5
  • GRAVY: -0.514679

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsOthercell envelope-related function transcriptional attenuator common domain (TIGR00350; HMM-score: 117.4)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype VII secretion protein EssA (TIGR03927; HMM-score: 15)
    Cellular processesCellular processesPathogenesistype II secretion system protein G (TIGR01710; HMM-score: 8.2)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype II secretion system protein G (TIGR01710; HMM-score: 8.2)
  • TheSEED:
  • PFAM:
    no clan definedLytR_cpsA_psr; Cell envelope-related transcriptional attenuator domain (PF03816; HMM-score: 170.4)
    DUF929; Domain of unknown function (DUF929) (PF06053; HMM-score: 16)
    DUF3671; Protein of unknown function (PF12420; HMM-score: 15.4)
    DUF5383; Family of unknown function (DUF5383) (PF17355; HMM-score: 15)
    Zn_Beta_Ribbon (CL0167) DUF2116; Uncharacterized protein containing a Zn-ribbon (DUF2116) (PF09889; HMM-score: 14)
    no clan definedDUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 12.7)
    Orf78; Orf78 (ac78) (PF06024; HMM-score: 12.6)
    Baculo_11_kDa; Baculovirus 11 kDa family (PF06143; HMM-score: 9.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.192
    • Ymax_pos: 34
    • Cmax: 0.189
    • Cmax_pos: 62
    • Smax: 0.432
    • Smax_pos: 32
    • Smean: 0.252
    • D: 0.215
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 446279120 NCBI
  • RefSeq: WP_000356975 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MDKETNDNEYRRQSEHRTSAPKRKKKKKIRKLPIILLIVVILLIALVVYIVHSYNSGVEYAKKHAKDVKVHQFNGPVKNDGKISILVLGADKAQGGQSRTDSIMVVQYDFINKKMKMMSVMRDIYADIPGYGKHKINSAYALGGPELLRKTLDKNLGINPEYYAVVDFTGFEKMIDELMPEGVPINVEKDMSKNIGVSLKKGNHRLNGKELLGYARFRHDPEGDFGRVRRQQQVMQTLKKEMVNFRTVVKLPKVAGILRGYVNTNIPDSGIFQTGLSFGIRGEKDVKSLTVPIKNSYEDVNTNTDGSALQINKNTNKQAIKDFLDED

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS07185 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]