From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS07410 [old locus tag: NWMN_1316 ]
  • pan locus tag?: SAUPAN003821000
  • symbol: NWMN_RS07410
  • pan gene symbol?:
  • synonym:
  • product: 5-bromo-4-chloroindolyl phosphate hydrolysis protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS07410 [old locus tag: NWMN_1316 ]
  • symbol: NWMN_RS07410
  • product: 5-bromo-4-chloroindolyl phosphate hydrolysis protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1447002..1447631
  • length: 630
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1447002..1447631) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGACAGTGAGATATAATATTTCTCATATATTTGGGGTGTTAGTGGGAATTCCTGTAGCG
    TTTTTAACAAGCATATTTGGGATGATTGCACTTGATGTATCTTTTTTAATTGATATGTCT
    ATTGGTATTGTTGGCTTTTTAATGACATACCTACCGATACAAAAACTCACTTCACGCAAA
    TATTTAAACGAAATTGGTTTGACTAGAAAAGACTATCGCTATATTCGAAATCAGTTAAAT
    CATACACACCAAAAACTTAGAGGTATTTTAAAAACGTATGTCAATATAAGATCAATTAAA
    GATTTTAGGCAGATTAATGATATATACCAAATTTCACGTTCTATTTATACGACAGTTAGA
    CAGAGACCTGCATCATTTTATAAAGTTGAAGGCTTTTTTTATTCTCATATTGATAATGCT
    TTAAATTTGGTTGATGCATATACACGTCTAGCAAAAATGCCCAAAAAATCAATTAATGAA
    CAGCAAAAGTTAGAACAAACACGAATTACTTTGGATGAGGTCAAACGAACATTAATCGCT
    GATTTAAAGCGTCTCAACGAAGATGATTATGAACGTTTAGATATTGAAATGGAATTAAAT
    AAGTTACATCAAAAACATCATCAAGATTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    630

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS07410 [old locus tag: NWMN_1316 ]
  • symbol: NWMN_RS07410
  • description: 5-bromo-4-chloroindolyl phosphate hydrolysis protein
  • length: 209
  • theoretical pI: 10.0552
  • theoretical MW: 24702.5
  • GRAVY: -0.304785

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesOtherreactive intermediate/imine deaminase (TIGR00004; HMM-score: 16.2)
    isopropylmalate/isohomocitrate dehydrogenases (TIGR02088; HMM-score: 12.5)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 12.3)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 12.3)
  • TheSEED:
  • PFAM:
    no clan definedHalogen_Hydrol; 5-bromo-4-chloroindolyl phosphate hydrolysis protein (PF10112; HMM-score: 208.5)
    JIP_LZII; JNK-interacting protein leucine zipper II (PF16471; HMM-score: 14.5)
    Syntaxin-6_N; Syntaxin 6, N-terminal (PF09177; HMM-score: 14.4)
    YjgF-like (CL0534) Ribonuc_L-PSP; Endoribonuclease L-PSP (PF01042; HMM-score: 13.9)
    no clan definedHJURP_C; Holliday junction regulator protein family C-terminal repeat (PF12347; HMM-score: 8.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 2
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.152
    • Ymax_pos: 17
    • Cmax: 0.131
    • Cmax_pos: 23
    • Smax: 0.284
    • Smax_pos: 6
    • Smean: 0.222
    • D: 0.179
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_001788788 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTVRYNISHIFGVLVGIPVAFLTSIFGMIALDVSFLIDMSIGIVGFLMTYLPIQKLTSRKYLNEIGLTRKDYRYIRNQLNHTHQKLRGILKTYVNIRSIKDFRQINDIYQISRSIYTTVRQRPASFYKVEGFFYSHIDNALNLVDAYTRLAKMPKKSINEQQKLEQTRITLDEVKRTLIADLKRLNEDDYERLDIEMELNKLHQKHHQD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS07410 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]