From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS07700 [old locus tag: NWMN_1367 ]
  • pan locus tag?: SAUPAN003916000
  • symbol: NWMN_RS07700
  • pan gene symbol?: birA
  • synonym:
  • product: bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS07700 [old locus tag: NWMN_1367 ]
  • symbol: NWMN_RS07700
  • product: bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor
  • replicon: chromosome
  • strand: -
  • coordinates: 1533486..1534457
  • length: 972
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1533486..1534457) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    ATGTCAAAATATAGTCAAGATGTACTTCAATTACTCTATAAAAATAAACCGAATTATATA
    TCTGGACAAAGCATTGCGGAATCACTTAATATTTCACGCACTGCAGTAAAAAAAGTGATT
    GACCAATTAAAGTTAGAGGGATGTAAAATAGATTCAGTAAATCATAAAGGGCATTTATTA
    CAACAGCTCCCAGATATTTGGTATCAAGGTATAATAGACCAATATACAAAAAGTTCTGCT
    TTGTTTGATTTTAGTGAAGTATACGATTCAATAGATTCTACACAACTTGCTGCGAAAAAG
    TCACTTGTTGGAAATCAATCTTCATTTTTTATCTTGAGTGATGAACAAACGAAAGGTCGT
    GGGCGATTTAATAGACATTGGAGTTCTTCAAAAGGGCAAGGACTTTGGATGTCTGTCGTG
    TTAAGACCTAACGTTGCATTCTCAATGATATCTAAATTTAATTTATTTATTGCATTAGGG
    ATAAGAGATGCGATTCAACATTTTAGTCAAGATGAAGTCAAAGTGAAATGGCCGAATGAT
    ATATATATTGATAATGGTAAAGTGTGTGGTTTCTTAACTGAAATGGTTGCTAATAATGAT
    GGTATAGAAGCAATAATATGTGGTATAGGTATTAATTTGACGCAACAACTAGAAAACTTT
    GATGAAAGTATTAGACATAGAGCAACAAGTATACAATTACATGATAAAAATAAATTAGAT
    AGATATCAATTTTTAGAGATATTACTTCAAGAAATTGAAAAAAGATATAATCAATTTTTA
    ACGTTACCTTTTTCTGAAATTCGTGAAGAATATACTGCAGCTTCTAATATTTGGAATAGA
    ACGTTGCTATTTACAGAAAATGATAAACAGTTTAAAGGACAAGCAATTGATTTAGATTAC
    GATGGCTATCTAATTGTTAGAGATGAAGCGGGTGAATCACACCGTTTAATTAGTGCAGAT
    ATAGATTTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    972

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS07700 [old locus tag: NWMN_1367 ]
  • symbol: NWMN_RS07700
  • description: bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor
  • length: 323
  • theoretical pI: 5.92816
  • theoretical MW: 37086.7
  • GRAVY: -0.360681

Function[edit source | edit]

  • reaction:
    ATP + biotin + apo-[acetyl-CoA:carbon-dioxide ligase (ADP-forming)] = AMP + diphosphate + [acetyl-CoA:carbon-dioxide ligase (ADP-forming)]?
  • TIGRFAM:
    Genetic information processingProtein fateProtein modification and repairbiotin--[acetyl-CoA-carboxylase] ligase (TIGR00121; EC 6.3.4.15; HMM-score: 180.1)
    Signal transductionRegulatory functionsDNA interactionsbiotin operon repressor (TIGR00122; HMM-score: 32.2)
    Signal transductionRegulatory functionsDNA interactionsTyrR family helix-turn-helix domain (TIGR04381; HMM-score: 15.1)
    Unknown functionGeneralRrf2 family protein (TIGR00738; HMM-score: 12.5)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 11.7)
  • TheSEED:
  • PFAM:
    HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 53.4)
    tRNA_synt_II (CL0040) BPL_LplA_LipB; Biotin/lipoate A/B protein ligase family (PF03099; HMM-score: 48.7)
    BPL_LplA_LipB_2; Biotin/lipoate A/B protein ligase family (PF16917; HMM-score: 21.8)
    TRB (CL0206) BPL_C; Biotin protein ligase C terminal domain (PF02237; HMM-score: 19.7)
    HTH (CL0123) HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 19.3)
    Rrf2; Transcriptional regulator (PF02082; HMM-score: 17.1)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 15.8)
    MarR; MarR family (PF01047; HMM-score: 14.8)
    Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 14)
    HTH_Mga; M protein trans-acting positive regulator (MGA) HTH domain (PF08280; HMM-score: 13.7)
    RPA_C; Replication protein A C terminal (PF08784; HMM-score: 13.6)
    Put_DNA-bind_N; Putative DNA-binding protein N-terminus (PF06971; HMM-score: 13.2)
    no clan definedPulG; Type II secretory pathway pseudopilin (PF11773; HMM-score: 12.8)
    HTH (CL0123) HTH_46; Winged helix-turn-helix DNA binding (PF15977; HMM-score: 12.3)
    GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 11.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.123
    • Ymax_pos: 27
    • Cmax: 0.124
    • Cmax_pos: 27
    • Smax: 0.183
    • Smax_pos: 35
    • Smean: 0.125
    • D: 0.124
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 445972064 NCBI
  • RefSeq: WP_000049919 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLEILLQEIEKRYNQFLTLPFSEIREEYTAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS07700 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]