From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS08400 [old locus tag: NWMN_1492 ]
  • pan locus tag?: SAUPAN004176000
  • symbol: NWMN_RS08400
  • pan gene symbol?: comEA
  • synonym:
  • product: competence protein ComE

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS08400 [old locus tag: NWMN_1492 ]
  • symbol: NWMN_RS08400
  • product: competence protein ComE
  • replicon: chromosome
  • strand: -
  • coordinates: 1660991..1661677
  • length: 687
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1660991..1661677) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    GTGGTTTTATTGTATCAATTTTTATTACGCTATAAAGATTTTTTAACTCAATGGAAGTTA
    TATATTCTAAGTGCTGTTGTTTTAATTATGGTATTAATTGGTTTTATATTCTGGAGACAA
    GATGATTATACTTCAAGAAATTTTGAAAATAAAGATACTGCTCTGAAACAAAGCACTAGT
    GAAAATAGTAGTTTGTCCAAAGTAGAAGATGTCCAGGTCAAAGATGGAGATAATTCCAAA
    AATAAGGGTCCTGTATATGTCGATGTAAAAGGTGCTGTTAAACATCCTAATGTTTATAAA
    ATGACATCTAAGGATAGAGTAGTTGATTTACTTGATAAAGCACAATTATTGGAGGATGCA
    GATGTAAGTCAAATTAATTTGTCTGAAAAATTAACAGATCAAAAAATGATTTTCATACCT
    CATAAAGGACAAAAGAATGTTGAACCACAAATTGAAGTAAACAGTGTGCACGAAAAAAAT
    GGGAACACAAATAATACTAAAGTAAATTTAAATACGGCATCTGTATCAGAATTGATGTCT
    GTTCCTGGAGTTGGGCAAGCTAAAGCTAATGCAATTGTTGAATATCGCAACCAACAAGGT
    GCATTTCAAGAAATTGACGATTTGAAAAAAGTAAAAGGTTTTGGAAGTAAAACTTTTGAT
    AAACTGAAATCTTATTTCACGACATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    687

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS08400 [old locus tag: NWMN_1492 ]
  • symbol: NWMN_RS08400
  • description: competence protein ComE
  • length: 228
  • theoretical pI: 9.36125
  • theoretical MW: 25863.3
  • GRAVY: -0.462719

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesDNA transformationcomEA protein (TIGR01259; HMM-score: 116.3)
    Cellular processesCellular processesDNA transformationcompetence protein ComEA helix-hairpin-helix repeat region (TIGR00426; HMM-score: 74.2)
    Unknown functionEnzymes of unknown specificityputative DNA modification/repair radical SAM protein (TIGR03916; HMM-score: 20.7)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairHolliday junction DNA helicase RuvA (TIGR00084; EC 3.6.4.12; HMM-score: 13.3)
    MetabolismTransport and binding proteinsNucleosides, purines and pyrimidinesnucleoside Transporter (TIGR00939; HMM-score: 12.4)
  • TheSEED:
  • PFAM:
    HHH (CL0198) HHH_3; Helix-hairpin-helix motif (PF12836; HMM-score: 89.7)
    HHH; Helix-hairpin-helix motif (PF00633; HMM-score: 46.1)
    HHH_5; Helix-hairpin-helix domain (PF14520; HMM-score: 29.3)
    Ubiquitin (CL0072) SLBB; SLBB domain (PF10531; HMM-score: 26.9)
    HHH (CL0198) HHH_2; Helix-hairpin-helix motif (PF12826; HMM-score: 22.4)
    HHH_6; Helix-hairpin-helix motif (PF14579; HMM-score: 19.8)
    T2SSK; Type II secretion system (T2SS), protein K (PF03934; HMM-score: 18.3)
    HHH_8; Helix-hairpin-helix domain (PF14716; HMM-score: 16)
    RNA_pol_A_CTD; Bacterial RNA polymerase, alpha chain C terminal domain (PF03118; HMM-score: 14.9)
    PsbU; Photosystem II 12 kDa extrinsic protein (PsbU) (PF06514; HMM-score: 14.8)
    O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 14.6)
    Aha1_BPI (CL0648) DUF1439; Protein of unknown function (DUF1439) (PF07273; HMM-score: 13.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.157
    • Ymax_pos: 45
    • Cmax: 0.113
    • Cmax_pos: 39
    • Smax: 0.449
    • Smax_pos: 37
    • Smean: 0.126
    • D: 0.145
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_001792568 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MVLLYQFLLRYKDFLTQWKLYILSAVVLIMVLIGFIFWRQDDYTSRNFENKDTALKQSTSENSSLSKVEDVQVKDGDNSKNKGPVYVDVKGAVKHPNVYKMTSKDRVVDLLDKAQLLEDADVSQINLSEKLTDQKMIFIPHKGQKNVEPQIEVNSVHEKNGNTNNTKVNLNTASVSELMSVPGVGQAKANAIVEYRNQQGAFQEIDDLKKVKGFGSKTFDKLKSYFTT

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS08400 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]