From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS08600 [old locus tag: NWMN_1532 ]
  • pan locus tag?: SAUPAN004235000
  • symbol: NWMN_RS08600
  • pan gene symbol?: aspS
  • synonym:
  • product: aspartate--tRNA ligase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS08600 [old locus tag: NWMN_1532 ]
  • symbol: NWMN_RS08600
  • product: aspartate--tRNA ligase
  • replicon: chromosome
  • strand: -
  • coordinates: 1696107..1697873
  • length: 1767
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1696107..1697873) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    1441
    1501
    1561
    1621
    1681
    1741
    ATGAGTAAGAGAACAACTTATTGTGGATTAGTTACTGAGGCATTTTTAGGACAAGAAATT
    ACATTAAAAGGATGGGTTAACAATCGTCGTGACCTTGGTGGATTGATTTTCGTTGATTTA
    AGAGATAGAGAAGGAATTGTACAAGTCGTGTTTAATCCTGCATTTTCAGAAGAGGCATTG
    AAAATTGCTGAAACAGTACGTTCTGAATATGTTGTAGAAGTTCAAGGTACAGTTACGAAG
    CGTGACCCTGAAACAGTTAATCCTAAAATTAAAACTGGCCAAGTTGAAGTACAAGTTACA
    AATATTAAAGTGATTAATAAATCTGAGACACCACCATTTTCTATAAATGAAGAAAATGTT
    AACGTTGATGAAAATATTCGATTAAAATACCGTTATTTAGATTTACGTCGTCAAGAGTTA
    GCGCAAACATTTAAAATGAGACATCAAATTACACGTTCTATTCGTCAATATTTGGATGAT
    GAAGGGTTCTTTGACATCGAAACACCAGTACTAACGAAGTCAACACCTGAGGGTGCACGT
    GACTATTTAGTACCATCTCGTGTTCATGATGGTGAATTTTATGCATTACCACAATCACCA
    CAATTATTTAAGCAATTATTGATGATTAGTGGATTTGACAAATACTACCAAATCGTAAAA
    TGCTTCCGTGACGAAGATTTACGTGCAGATCGTCAACCTGAATTTACACAAGTCGATATT
    GAAATGAGTTTTGTAGACCAAGAAGATGTGATGCAAATGGGTGAAGAAATGCTTAAAAAA
    GTTGTTAAAGAAGTTAAAGGCGTTGAAATTAATGGCGCTTTCCCACGCATGACATATAAA
    GAAGCGATGCGTCGCTATGGTTCTGATAAACCAGATACACGTTTTGAAATGGAATTAATT
    GACGTTTCTCAATTAGGACGTGATATGGACTTTAAAGTATTTAAAGATACTGTTGAAAAT
    GATGGTGAAATTAAAGCAATTGTCGCTAAAGGTGCAGCTGAACAATATACTCGTAAAGAT
    ATGGATGCTTTAACAGAATTTGTAAACATCTATGGTGCTAAAGGATTAGCGTGGGTTAAA
    GTTGTGGAAGATGGTTTGACAGGTCCAATTGGACGTTTCTTTGAAACAGAAAATGTTGAA
    ACATTACTTACATTAACTGGTGCTGAAGCTGGTGACTTAGTAATGTTTGTTGCAGACAAA
    CCAAATGTCGTTGCACAAAGTTTAGGTGCATTACGTGTCAAATTAGCTAAAGAATTAGGT
    TTAATCGATGAAACAAAATTAAACTTCTTATGGGTGACAGATTGGCCATTATTAGAATAT
    GATGAAGATGCGAAACGTTACGTTGCAGCACATCATCCATTTACATCTCCAAAAGAAGCT
    GATATTGCTAAGCTTGGCACTGCGCCAGAAGAAGCTGAGGCAAATGCTTATGACATAGTA
    TTAAATGGTTATGAATTAGGTGGCGGTTCAATCAGAATTCATGATGGTGAGTTACAAGAA
    AAAATGTTCGAAGTTCTTGGATTTACTAAAGAACAAGCACAAGAACAGTTCGGCTTCTTA
    CTAGATGCATTTAAATATGGTGCACCACCACATGGCGGTATTGCATTAGGATTAGACCGA
    TTAGTCATGTTATTGACTAATAGAACAAACTTGAGAGATACAATCGCATTCCCTAAAACA
    GCATCTGCTACATGTTTATTAACGAATGCGCCTGGTGAAGTTTCTGATAAACAATTAGAA
    GAACTTTCTTTGCGAATTCGTCACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1440
    1500
    1560
    1620
    1680
    1740
    1767

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS08600 [old locus tag: NWMN_1532 ]
  • symbol: NWMN_RS08600
  • description: aspartate--tRNA ligase
  • length: 588
  • theoretical pI: 4.69429
  • theoretical MW: 66598.4
  • GRAVY: -0.355272

Function[edit source | edit]

  • reaction:
    EC 6.1.1.12?  ExPASy
    Aspartate--tRNA ligaseATP + L-aspartate + tRNA(Asp) = AMP + diphosphate + L-aspartyl-tRNA(Asp)
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA aminoacylationaspartate--tRNA ligase (TIGR00459; EC 6.1.1.-; HMM-score: 855.8)
    Genetic information processingProtein synthesistRNA aminoacylationaspartate--tRNA(Asn) ligase (TIGR00458; EC 6.1.1.23; HMM-score: 253.8)
    Genetic information processingProtein synthesistRNA aminoacylationasparagine--tRNA ligase (TIGR00457; EC 6.1.1.22; HMM-score: 167.8)
    Genetic information processingProtein synthesistRNA aminoacylationlysine--tRNA ligase (TIGR00499; EC 6.1.1.6; HMM-score: 166.9)
    Unknown functionGeneralEF-P lysine aminoacylase GenX (TIGR00462; HMM-score: 91.8)
    Genetic information processingProtein synthesistRNA aminoacylationhistidine--tRNA ligase (TIGR00442; EC 6.1.1.21; HMM-score: 24.4)
    Genetic information processingProtein synthesistRNA aminoacylationpyrrolysine--tRNA ligase, C-terminal region (TIGR02367; EC 6.1.1.26; HMM-score: 16.2)
    Genetic information processingProtein synthesistRNA aminoacylationphenylalanine--tRNA ligase, alpha subunit (TIGR00468; EC 6.1.1.20; HMM-score: 9.9)
  • TheSEED:
  • PFAM:
    tRNA_synt_II (CL0040) tRNA-synt_2; tRNA synthetases class II (D, K and N) (PF00152; HMM-score: 379.3)
    GAD (CL0250) GAD; GAD domain (PF02938; HMM-score: 99.3)
    OB (CL0021) tRNA_anti-codon; OB-fold nucleic acid binding domain (PF01336; HMM-score: 65.7)
    tRNA_synt_II (CL0040) tRNA-synt_2d; tRNA synthetases class II core domain (F) (PF01409; HMM-score: 20.6)
    tRNA-synt_2b; tRNA synthetase class II core domain (G, H, P, S and T) (PF00587; HMM-score: 16.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_RS02940DNA-directed RNA polymerase subunit beta'  [1] (data from MRSA252)
    NWMN_RS02960elongation factor G  [1] (data from MRSA252)
    NWMN_RS02965elongation factor Tu  [1] (data from MRSA252)
    NWMN_RS05385pyruvate dehydrogenase E1 component subunit beta  [1] (data from MRSA252)
    NWMN_RS05395dihydrolipoyl dehydrogenase  [1] (data from MRSA252)
    NWMN_RS06520succinyl-CoA ligase subunit alpha  [1] (data from MRSA252)
    NWMN_RS0657530S ribosomal protein S2  [1] (data from MRSA252)
    NWMN_RS08905isocitrate dehydrogenase (NADP(+))  [1] (data from MRSA252)
    NWMN_RS08930pyruvate kinase  [1] (data from MRSA252)
    NWMN_RS08995universal stress protein UspA  [1] (data from MRSA252)
    NWMN_RS11875glutamine--fructose-6-phosphate aminotransferase  [1] (data from MRSA252)
    NWMN_RS12080Asp23/Gls24 family envelope stress response protein  [1] (data from MRSA252)
    NWMN_RS1226030S ribosomal protein S9  [1] (data from MRSA252)
    NWMN_RS1234030S ribosomal protein S5  [1] (data from MRSA252)
    NWMN_RS1239530S ribosomal protein S3  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.127
    • Ymax_pos: 11
    • Cmax: 0.124
    • Cmax_pos: 25
    • Smax: 0.277
    • Smax_pos: 1
    • Smean: 0.129
    • D: 0.128
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 445966944 NCBI
  • RefSeq: WP_000044799 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSKRTTYCGLVTEAFLGQEITLKGWVNNRRDLGGLIFVDLRDREGIVQVVFNPAFSEEALKIAETVRSEYVVEVQGTVTKRDPETVNPKIKTGQVEVQVTNIKVINKSETPPFSINEENVNVDENIRLKYRYLDLRRQELAQTFKMRHQITRSIRQYLDDEGFFDIETPVLTKSTPEGARDYLVPSRVHDGEFYALPQSPQLFKQLLMISGFDKYYQIVKCFRDEDLRADRQPEFTQVDIEMSFVDQEDVMQMGEEMLKKVVKEVKGVEINGAFPRMTYKEAMRRYGSDKPDTRFEMELIDVSQLGRDMDFKVFKDTVENDGEIKAIVAKGAAEQYTRKDMDALTEFVNIYGAKGLAWVKVVEDGLTGPIGRFFETENVETLLTLTGAEAGDLVMFVADKPNVVAQSLGALRVKLAKELGLIDETKLNFLWVTDWPLLEYDEDAKRYVAAHHPFTSPKEADIAKLGTAPEEAEANAYDIVLNGYELGGGSIRIHDGELQEKMFEVLGFTKEQAQEQFGFLLDAFKYGAPPHGGIALGLDRLVMLLTNRTNLRDTIAFPKTASATCLLTNAPGEVSDKQLEELSLRIRH

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS08600 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]