From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS08740 [old locus tag: NWMN_1559 ]
  • pan locus tag?: SAUPAN004277000
  • symbol: NWMN_RS08740
  • pan gene symbol?: tag
  • synonym:
  • product: DNA-3-methyladenine glycosylase I

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS08740 [old locus tag: NWMN_1559 ]
  • symbol: NWMN_RS08740
  • product: DNA-3-methyladenine glycosylase I
  • replicon: chromosome
  • strand: +
  • coordinates: 1725508..1726068
  • length: 561
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1725508..1726068) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAATGAATGCGCATTTGGTACTAAAGATCCAGTCTACTTAGACTATCATGATCATGTA
    TGGGGACAACCGCTCTATGATAGCAAGGCATTGTTTAAACTTTTAGCATTAGAATCACAA
    CATGCTGGGCTATCTTGGTTAACTATTTTAAAAAAGAAAGAAGCCTATGAAGAAGCATTT
    TATGATTTCGAACCAGAAAAGGTAGCACAAATGACCGCTCAAGATATCGACCGCTTAATG
    ACTTTTCCAAATATCGTTCATCATCGTAAAAAATTAGAAGCAATTGTTAATCAAGCTCAA
    GGGTATTTAAAAATTGAACAAGCATATGGTAGTTTTAGTAAATTTTTATGGTCATATGTA
    AATGGTAAGCCTAAAGATTTGCAGTATGAACATGCTTCTGATCGTATCACAGTTGATGAT
    ACTGCAACACAACTATCTAAAGATTTAAAACAATACGGGTTTAAATTTTTAGGTCCAGTA
    ACAGTATTTTCGTTTTTAGAAGCAGCCGGTTTATATGATGCACATTTACAAGATTGTCCA
    TCAAAGCCTAAACATAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    561

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS08740 [old locus tag: NWMN_1559 ]
  • symbol: NWMN_RS08740
  • description: DNA-3-methyladenine glycosylase I
  • length: 186
  • theoretical pI: 6.50996
  • theoretical MW: 21416.1
  • GRAVY: -0.476882

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA-3-methyladenine glycosylase I (TIGR00624; EC 3.2.2.20; HMM-score: 190.7)
  • TheSEED:
  • PFAM:
    no clan definedAdenine_glyco; Methyladenine glycosylase (PF03352; HMM-score: 215)
    COOH-NH2_lig; Phage phiEco32-like COOH.NH2 ligase-type 2 (PF14395; HMM-score: 11.7)
    DUF3326; Protein of unknown function (DUF3326) (PF11805; HMM-score: 11)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.119
    • Ymax_pos: 56
    • Cmax: 0.121
    • Cmax_pos: 56
    • Smax: 0.189
    • Smax_pos: 41
    • Smean: 0.077
    • D: 0.103
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446923972 NCBI
  • RefSeq: WP_001001228 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNECAFGTKDPVYLDYHDHVWGQPLYDSKALFKLLALESQHAGLSWLTILKKKEAYEEAFYDFEPEKVAQMTAQDIDRLMTFPNIVHHRKKLEAIVNQAQGYLKIEQAYGSFSKFLWSYVNGKPKDLQYEHASDRITVDDTATQLSKDLKQYGFKFLGPVTVFSFLEAAGLYDAHLQDCPSKPKHN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS08740 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]